CCL14 active protein

Human CCL14 (HCC-1)

Cat. Num. AAA444012

• Gene Names: Hspa1l; Msh5; Hsc70t
• Purity: > 97% by SDS PAGE
• Synonyms: CCL14; Human CCL14 (HCC-1); CCL14 (HCC-1) Biotin; CCL14 active protein

• Host: E Coli derived
• Purity/Purification: > 97% by SDS PAGE
• Form/Format: Lyophilized
• Sequence Positions: 28-93
• Sequence: GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQD YIKDMKEN
• Sequence Length: 641

• Reconstitution: Spin sample prior to reconstitution. Recommended at 100mug/mL in sterile water
• Carrier Protein: None
• Activity: EC50 = 0.1-0.4 nM determined by Migration Assay with cells expressing recombinant CCR1
• Extinction Coefficient: 13,850 M-1 cm-1
• Endotoxin Level: <0.01 EU per 1mug of the protein by the LAL method
• Modification: None
• UNSPSC Code: 12352202
• Preparation and Storage: Avoid repeated freeze-thaw cycles; 12 months from date of receipt, -20 to -70 degree C as supplied.; 1 month, 2 to 8 degree C under sterile conditions after reconstitution.; 3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Related Product Information for CCL14 active protein

Hemofiltrate CC chemokine-1(HCC-1/CCL14) is endogeneously expressed by numerous tissues. Upon processing of the N terminal residues of the full length HCC-1 by the uPA-plasmin system, the active form of HCC-1 (made by ChemoTactics) is a strong agonist for CCR1, CCR5 and to a lesser extent CCR3, and causes chemotaxis of different types of leukocytes. The active form of HCC-1 is also shown as a potent inhibitor of HIV entry.

References

1. "HCC-1, a novel chemokine from human plasma" Schulz-Knappe P., Mägert H., Dewald B., J Exp Med 183:295-299 (1996)
2. "Urokinase Plasminogen Activator and Plasmin Efficiently Convert Hemofiltrate CC Chemokine 1 into Its Active [9-74] Processed Variant" Vakili J., Standker L., Detheux M., Vassart, G., Forssmann W., Parmentier M. J Immunol 167:3406-3413 (2001)

NCBI and Uniprot Product Information

• NCBI GI #: 124339838
• NCBI GeneID: 15482
• NCBI Accession #: NP_038586.2
• NCBI GenBank Nucleotide #: NM_013558.2
• UniProt Accession #: P16627; O88686; Q61693
• Molecular Weight: Actual Molecular Mass: Mass spec data confirmed the expected mass of 7.801 kDa; Predicted Molecular Mass: 7.801 kDa
• NCBI Official Full Name: heat shock 70 kDa protein 1-like
• NCBI Official Synonym Full Names: heat shock protein 1-like
• NCBI Official Symbol: Hspa1l
• NCBI Official Synonym Symbols: Msh5; Hsc70t
• NCBI Protein Information: heat shock 70 kDa protein 1-like; heat shock 70 kDa protein 1L; heat shock 70 kDa-like protein 1; heat shock 70kDa protein 1-like; heat shock protein cognate 70, testis; heat shock-related protein hsc70t; inducible heat shock protein 70; spermatid-specific heat shock protein 70
• UniProt Protein Name: Heat shock 70 kDa protein 1-like
• Protein Family: C-C motif chemokine
• UniProt Gene Name: Hspa1l
• UniProt Synonym Gene Names: Hsc70t; Heat shock 70 kDa protein 1L
• UniProt Entry Name: HS71L_MOUSE

Uniprot Description

HSPA1L: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Not induced by heat shock. Expressed in spermatids. Belongs to the heat shock protein 70 family.

Protein type: Heat shock protein; Chaperone; Mitochondrial

Cellular Component: signalosome; cytosol

Molecular Function: unfolded protein binding; nucleotide binding; ATP binding

Biological Process: binding of sperm to zona pellucida; multicellular organismal development; spermatogenesis; protein refolding; cell differentiation