CCL5 active protein

Human CCL5 (RANTES)

Cat. Num. AAA444003

• Gene Names: CCL5; SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
• Purity: > 97% by SDS PAGE
• Synonyms: CCL5; Human CCL5 (RANTES); CCL5 (Rantes); CCL5 active protein

• Host: E Coli derived
• Purity/Purification: > 97% by SDS PAGE
• Form/Format: Lyophilized
• Sequence Positions: 24-91
• Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWV REYINSLEMS
• Sequence Length: 91

• Reconstitution: Spin sample prior to reconstitution. Recommended at 100mug/mL in sterile water
• Carrier Protein: None
• Activity: EC50 = 0.13nM determined by migration assay with cells expressing recombinant CCR5
• Extinction Coefficient: 12,570 M-1 cm-1
• Endotoxin Level: <0.01 EU per 1mug of the protein by the LAL method
• Modification: None
• UNSPSC Code: 12352202
• Preparation and Storage: Avoid repeated freeze-thaw cycles; 12 months from date of receipt, -20 to -70 degree C as supplied.; 1 month, 2 to 8 degree C under sterile conditions after reconstitution.; 3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

Related Product Information for CCL5 active protein

Regulated on Activation, Normal T cell Expressed and Secreted (RANTES) (CCL5) is a proinflammatory chemokine that induces migration and activation of leukocytes, as well as implication in HIV infection. It binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infection displays dependence on concentration and on the binding of cell surface glycosaminoglycans.

References

1. "RANTES: a versatile and controversial chemokine" Appay V., Rowland-Jones S.L. Trends Immunol 22:83-87 (2001)
2. "Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive fac tors produced by CD8+T cells" Cocchi F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
3. A human T cell-specific molecule is a member of a new gene family. Schall T.J., Jongstra J., Dyer B.J., Jorgensen J., Clayberger C., Davis M.M., Krensky A.M. J Immunol 141:1018-1025 (1988)
4. "Engineering the glycosaminoglycan-binding affinity, kinetics and oligomerization behavior of RANTES: a tool for generating chemokine-based glycosaminoglycan antagonists" Brandner B., Rek A., Diedrichs-Möhring M., Wildner G., Kungl A.J. Protein Eng Des Sel. 22:367-373 (2009)

NCBI and Uniprot Product Information

• NCBI GI #: 22538814
• NCBI GeneID: 6352
• NCBI Accession #: NP_002976.2
• NCBI GenBank Nucleotide #: NM_002985.2
• UniProt Accession #: P13501; O43646; Q0QVW8; Q4ZGJ1; Q9NYA2; Q9UBG2; Q9UC99
• Molecular Weight: Actual Molecular Mass: Mass Spec data confirmed expected mass of 7.851kDa; Predicted Molecular Mass: 7.851 kDa
• NCBI Official Full Name: C-C motif chemokine 5 isoform 1
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 5
• NCBI Official Symbol: CCL5
• NCBI Official Synonym Symbols: SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
• NCBI Protein Information: C-C motif chemokine 5; T-cell specific protein p288; beta-chemokine RANTES; eosinophil chemotactic cytokine; regulated upon activation, normally T-expressed, and presumably secreted; small inducible cytokine subfamily A (Cys-Cys), member 5
• UniProt Protein Name: C-C motif chemokine 5
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL5
• UniProt Synonym Gene Names: D17S136E; SCYA5; TCP228
• UniProt Entry Name: CCL5_HUMAN

NCBI Description

This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

CCL5: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T- cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. By mitogens. T-cell and macrophage specific. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted; Chemokine; Cell adhesion

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: protein homodimerization activity; protein self-association; receptor signaling protein tyrosine kinase activator activity; phosphoinositide phospholipase C activity; protein kinase activity; protein binding; CCR1 chemokine receptor binding; CCR4 chemokine receptor binding; chemokine receptor binding; chemokine activity; chemokine receptor antagonist activity; phospholipase activator activity; CCR5 chemokine receptor binding; chemoattractant activity

Biological Process: regulation of chronic inflammatory response; exocytosis; positive regulation of cell adhesion; response to toxin; positive regulation of smooth muscle cell proliferation; positive regulation of JAK-STAT cascade; chemotaxis; positive regulation of smooth muscle cell migration; protein amino acid phosphorylation; positive regulation of cell-cell adhesion mediated by integrin; positive regulation of homotypic cell-cell adhesion; positive regulation of translational initiation; monocyte chemotaxis; leukocyte adhesion; positive chemotaxis; cell-cell signaling; calcium ion transport; positive regulation of innate immune response; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; dendritic cell chemotaxis; positive regulation of T cell proliferation; inflammatory response; protein tetramerization; phospholipase D activation; positive regulation of viral genome replication; neutrophil activation; negative regulation of G-protein coupled receptor protein signaling pathway; response to virus; MAPKKK cascade; positive regulation of cellular biosynthetic process; macrophage chemotaxis; positive regulation of phosphoinositide 3-kinase cascade; cellular calcium ion homeostasis; G-protein coupled receptor protein signaling pathway; cellular protein complex assembly; negative regulation of viral genome replication; positive regulation of tyrosine phosphorylation of STAT protein; eosinophil chemotaxis; positive regulation of calcium ion transport; regulation of insulin secretion; positive regulation of phosphorylation; positive regulation of epithelial cell proliferation; regulation of T cell activation; positive regulation of cell migration