Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

CCL5 active protein

Human CCL5 (RANTES)

Gene Names
CCL5; SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
Purity
> 97% by SDS PAGE
Synonyms
CCL5; Human CCL5 (RANTES); CCL5 (Rantes) Biotin; CCL5 active protein
Ordering
For Research Use Only!
Host
E Coli derived
Purity/Purification
> 97% by SDS PAGE
Form/Format
Lyophilized
Sequence Positions
24-91
Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWV REYINSLEMS
Sequence Length
91
Reconstitution
Spin sample prior to reconstitution. Recommended at 100mug/mL in sterile water
Carrier Protein
None
Activity
EC50 = 0.13nM determined by migration assay with cells expressing recombinant CCR5
Extinction Coefficient
12,570 M-1 cm-1
Endotoxin Level
<0.01 EU per 1mug of the protein by the LAL method
Modification
None
UNSPSC Code
12352202
Preparation and Storage
Avoid repeated freeze-thaw cycles
12 months from date of receipt, -20 to -70 degree C as supplied.
1 month, 2 to 8 degree C under sterile conditions after reconstitution.
3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

Testing Data
Related Product Information for CCL5 active protein
Regulated on Activation, Normal T cell Expressed and Secreted (RANTES) (CCL5) is a proinflammatory chemokine that induces migration and activation of leukocytes, as well as implication in HIV infection. It binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infection displays dependence on concentration and on the binding of cell surface glycosaminoglycans.
References
1. "RANTES: a versatile and controversial chemokine" Appay V., Rowland-Jones S.L. Trends Immunol 22:83-87 (2001)
2. "Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive fac tors produced by CD8+T cells" Cocchi F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
3. A human T cell-specific molecule is a member of a new gene family. Schall T.J., Jongstra J., Dyer B.J., Jorgensen J., Clayberger C., Davis M.M., Krensky A.M. J Immunol 141:1018-1025 (1988)
4. "Engineering the glycosaminoglycan-binding affinity, kinetics and oligomerization behavior of RANTES: a tool for generating chemokine-based glycosaminoglycan antagonists" Brandner B., Rek A., Diedrichs-Möhring M., Wildner G., Kungl A.J. Protein Eng Des Sel. 22:367-373 (2009)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Actual Molecular Mass: Mass Spec data confirmed expected mass of 7.851kDa
Predicted Molecular Mass: 7.851 kDa
NCBI Official Full Name
C-C motif chemokine 5 isoform 1
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 5
NCBI Official Symbol
CCL5
NCBI Official Synonym Symbols
SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
NCBI Protein Information
C-C motif chemokine 5; T-cell specific protein p288; beta-chemokine RANTES; eosinophil chemotactic cytokine; regulated upon activation, normally T-expressed, and presumably secreted; small inducible cytokine subfamily A (Cys-Cys), member 5
Protein Family
UniProt Gene Name
CCL5
UniProt Synonym Gene Names
D17S136E; SCYA5; TCP228
UniProt Entry Name
CCL5_HUMAN

NCBI Description

This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

CCL5: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T- cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. By mitogens. T-cell and macrophage specific. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted; Cell adhesion; Chemokine; Secreted, signal peptide; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: CCR4 chemokine receptor binding; CCR1 chemokine receptor binding; protein binding; protein homodimerization activity; protein self-association; chemokine activity; chemokine receptor binding; chemokine receptor antagonist activity; receptor signaling protein tyrosine kinase activator activity; phosphoinositide phospholipase C activity; chemoattractant activity; phospholipase activator activity; CCR5 chemokine receptor binding; protein kinase activity

Biological Process: regulation of chronic inflammatory response; positive regulation of cell adhesion; exocytosis; response to toxin; positive regulation of smooth muscle cell proliferation; positive regulation of JAK-STAT cascade; chemotaxis; positive regulation of smooth muscle cell migration; positive regulation of cell-cell adhesion mediated by integrin; protein amino acid phosphorylation; positive regulation of homotypic cell-cell adhesion; positive regulation of translational initiation; monocyte chemotaxis; leukocyte adhesion; positive chemotaxis; cell-cell signaling; calcium ion transport; positive regulation of innate immune response; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; dendritic cell chemotaxis; positive regulation of T cell proliferation; inflammatory response; protein tetramerization; phospholipase D activation; positive regulation of viral genome replication; neutrophil activation; negative regulation of G-protein coupled receptor protein signaling pathway; response to virus; MAPKKK cascade; positive regulation of cellular biosynthetic process; macrophage chemotaxis; cellular calcium ion homeostasis; positive regulation of phosphoinositide 3-kinase cascade; G-protein coupled receptor protein signaling pathway; cellular protein complex assembly; negative regulation of viral genome replication; positive regulation of tyrosine phosphorylation of STAT protein; eosinophil chemotaxis; positive regulation of calcium ion transport; regulation of insulin secretion; positive regulation of epithelial cell proliferation; positive regulation of phosphorylation; positive regulation of cell migration; regulation of T cell activation

Research Articles on CCL5

Similar Products

Product Notes

The CCL5 ccl5 (Catalog #AAA444018) is an Active Protein produced from E Coli derived and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-91. The amino acid sequence is listed below: SPYSSDTTPC CFAYIARPLP RAHIKEYFYT SGKCSNPAVV FVTRKNRQVC ANPEKKWV REYINSLEMS. It is sometimes possible for the material contained within the vial of "CCL5, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.