CCL4 active protein

Human CCL4 (MIP-1beta)

Cat. Num. AAA444017

• Gene Names: CCL4; ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta
• Purity: > 97% by SDS PAGE
• Synonyms: CCL4; Human CCL4 (MIP-1beta); CCL4 (MIP-1beta) Biotin; CCL4 active protein

• Host: E Coli derived
• Purity/Purification: > 97% by SDS PAGE
• Form/Format: Lyophilized
• Sequence Positions: 24-92
• Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES WVQEYVYDLELN
• Sequence Length: 92

• Reconstitution: Spin sample prior to reconstitution. Recommended at 100mug/mL in sterile water.
• Carrier Protein: None
• Activity: EC50 = 0.23nM determined by Migration Assay with cells expressing recombinant CCR5
• Extinction Coefficient: 12570 M-1 cm-1
• Endotoxin Level: <0.01 EU per 1mug of the protein by the LAL method
• Modification: None
• UNSPSC Code: 12352202
• Preparation and Storage: Avoid repeated freeze-thaw cycles; 12 months from date of receipt, -20 to -70 degree C as supplied.; 1 month, 2 to 8 degree C under sterile conditions after reconstitution.; 3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

Related Product Information for CCL4 active protein

Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.

References

1. "Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells." Cocchi F., DeVico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
2. "The assignment of chemokine-chemokine receptor pairs: TARC and MIP-1 beta are not ligands for human CC-chemokine receptor 8." Garlisi C.G., Xiao H., Tian F., Hedrick J.A., Billah M.M., Egan R.W., Umland S.P. Eur. J. Immunol. 29:3210-3215 (1999)
3. "Natural truncation of the chemokine MIP-1beta/CCL4 affects receptor specificity but not anti-HIV-1 activity." Guan E., Wang J., Roderiquez G., Norcross M.A. J. Biol. Chem. 277:32348-32352 (2002)

NCBI and Uniprot Product Information

• NCBI GI #: 4506845
• NCBI GeneID: 6351
• NCBI Accession #: NP_002975.1
• NCBI GenBank Nucleotide #: NM_002984.3
• UniProt Accession #: P13236; P22617; Q13704; Q3SXL8; Q6FGI8
• Molecular Weight: Actual Molecular Mass: Mass spec data confirmed the expected mass of 7.818 kDa; Predicted Molecular Mass: 7.818 kDa
• NCBI Official Full Name: C-C motif chemokine 4
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 4
• NCBI Official Symbol: CCL4
• NCBI Official Synonym Symbols: ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta
• NCBI Protein Information: C-C motif chemokine 4; G-26 T-lymphocyte-secreted protein; MIP-1-beta(1-69); PAT 744; SIS-gamma; T-cell activation protein 2; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; secreted protein G-26; small inducible cytokine A4 (homologous to mouse Mip-1b)
• UniProt Protein Name: C-C motif chemokine 4
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL4
• UniProt Synonym Gene Names: LAG1; MIP1B; SCYA4; LAG-1; MIP-1-beta; ACT-2
• UniProt Entry Name: CCL4_HUMAN

NCBI Description

The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012]

Uniprot Description

CCL4: Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5- mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Chemokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space; extracellular region

Molecular Function: identical protein binding; protein binding; CCR1 chemokine receptor binding; chemokine activity; cytokine activity; CCR5 chemokine receptor binding

Biological Process: cell-cell signaling; response to toxin; response to virus; establishment and/or maintenance of cell polarity; immune response; positive regulation of calcium-mediated signaling; signal transduction; positive regulation of calcium ion transport; inflammatory response; cell adhesion; cell motility