CCL28 active protein

Human CCL28 (MEC)

Cat. Num. AAA444015

• Gene Names: CCL28; MEC; CCK1; SCYA28
• Purity: > 97% by SDS PAGE
• Synonyms: CCL28; Human CCL28 (MEC); CCL28 (MEC) Biotin; CCL28 active protein

• Host: E Coli derived
• Purity/Purification: > 97% by SDS PAGE
• Form/Format: Lyophilized
• Sequence Positions: 23-127
• Sequence: ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVK QWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
• Sequence Length: 127

• Reconstitution: Spin sample prior to reconstitution. Recommended at 100mug/mL in sterile water
• Carrier Protein: None
• Activity: EC50 = 38nM determined by migration assay with cells expressing recombinant CCR10
• Extinction Coefficient: 8,970 M-1 cm-1
• Endotoxin Level: <0.01 EU per 1mug of the protein by the LAL method
• Modification: None
• UNSPSC Code: 12352202
• Preparation and Storage: Avoid repeated freeze-thaw cycles; 12 months from date of receipt, -20 to -70 degree C as supplied.; 1 month, 2 to 8 degree C under sterile conditions after reconstitution.; 3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

Related Product Information for CCL28 active protein

Mucosae-associated epithelial chemokine (MEC/CCL28) is secreted by epithelial cells of gastrointestinal and nonintestinal mucosal cells, and regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. It shows broad-spectrum antibacterial activities, and could also be useful in vaccination of HIV infeaction.

References

1. "A novel chemokine ligand for CCR10 and CCR3 expressed by epithelial cells in mucosal tissues" Pan et al. J. Immunol. 165: 2943-2949 (2000)
2. Identification of a novel chemokine (CCL28), which binds CCR10 (GPR2). Wang et al. J. Biol. Chem. 275: 22313-22323 (2000)
3. "The Mucosae-Associated Epithelial Chemokine (MEC/CCL28) Modulates Immunity in HIV Infection" Castelletti E. at al. PLoS ONE 2:e969 (2007)

NCBI and Uniprot Product Information

• NCBI GI #: 687569447
• NCBI GeneID: 56477
• NCBI Accession #: NP_001288802.1
• NCBI GenBank Nucleotide #: NM_001301873.1
• UniProt Accession #: Q9NRJ3; D7RIE7
• Molecular Weight: Actual Molecular Mass: Mass Spec data confirmed expected mass of 12.031kDa; Predicted Molecular Mass: 12.031 kDa
• NCBI Official Full Name: C-C motif chemokine 28 isoform a
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 28
• NCBI Official Symbol: CCL28
• NCBI Official Synonym Symbols: MEC; CCK1; SCYA28
• NCBI Protein Information: C-C motif chemokine 28; CC chemokine CCL28; chemokine (C-C motif) ligand 28 splice variant chi; mucosae-associated epithelial chemokine; small inducible cytokine A28; small inducible cytokine subfamily A (Cys-Cys), member 28; small-inducible cytokine A28
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL28
• UniProt Synonym Gene Names: SCYA28; MEC
• UniProt Entry Name: CCL28_HUMAN

NCBI Description

This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]

Uniprot Description

CCL28: Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide; Chemokine

Chromosomal Location of Human Ortholog: 5p12

Cellular Component: extracellular space; extracellular region

Molecular Function: chemokine activity

Biological Process: elevation of cytosolic calcium ion concentration; immune response; chemotaxis; positive regulation of cell-matrix adhesion; response to nutrient