Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3beta. Responses are expressed as the % of total input cells.)

CCL19 active protein

Human CCL19 (MIP-3beta)

Purity
> 97% by SDS PAGE
Synonyms
CCL19; Human CCL19 (MIP-3beta); CCL19 (MIP-3beta); CCL19 active protein
Ordering
For Research Use Only!
Host
E Coli derived
Purity/Purification
> 97% by SDS PAGE
Form/Format
Lyophilized
Sequence Positions
22-98
Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPW VERIIQRLQRTSAKMKRRSS
Reconstitution
Spin sample prior to reconstitution. Recommended at 100mug/mL in sterile water
Carrier Protein
None
Activity
EC50 =7.2nM determined by migration assay with cells expressing recombinant CCR7
Extinction Coefficient
8,730 M-1 cm-1
Endotoxin Level
<0.01 EU per 1mug of the protein by the LAL method
Modification
None
UNSPSC Code
12352202
Preparation and Storage
Avoid repeated freeze-thaw cycles
12 months from date of receipt, -20 to -70 degree C as supplied.
1 month, 2 to 8 degree C under sterile conditions after reconstitution.
3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

(Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3beta. Responses are expressed as the % of total input cells.)

Testing Data (Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3beta. Responses are expressed as the % of total input cells.)
Related Product Information for CCL19 active protein
Macrophage inflammatory protein-3-beta (MIP3beta) (CCL19), also known as EBI1 ligand chemokine (ELC), directs chemotaxis of dendritic cells, and certain B- and T- lymphocytes, but not monocytes or granulocytes. It is constituitively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. Being a homeostatic chemokine, its primary physiological role is considered to be in the normal recirculation and homing of lymphocyte. However, MIP3beta could also be proinfammatory, and is implicated in the post-HIV infection responses.
References
1. "Molecular Cloning of a Novel Human CC Chemokine EBI1-ligand Chemokine That Is a Specific Functional Ligand for EBI1, CCR7" Yoshida R., Imai T., Hieshima K., Kusuda J., Baba M., Kitaura M., Nishimura M., Kakizaki M., Nomiyama H., Yoshie O.J Biol Chem 272:13803-13809 (1997)
2. "CK beta-11/macrophage inflammatory protein-3 beta/EBI1-ligand chemokine is an efficacious chemoattractant for T and B cells."Kim C.H., Pelus L.M., White J.R., Applebaum E., Johanson K., Broxmeyer H.E. J. Immunol. 160:2418-2424(1998)
3. "Homeostatic chemokines CCL19 and CCL21 promote inflammation in human immunodeficiency virus-infected patients with ongoing viral replication." Damås J.K., Landrø L., Fevang B., Heggelund L., Tjønnfjord G.E., Fløisand Y., Halvorsen B., Frøland S.S., Aukrust P. Clin Exp Immunol. 157:400-7 (2009)

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
Actual Molecular Mass: Mass Spec data confirmed expected mass of 8.800 kDa
Predicted Molecular Mass: 8.800 kDa
Protein Family

Similar Products

Product Notes

The CCL19 (Catalog #AAA444010) is an Active Protein produced from E Coli derived and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-98. The amino acid sequence is listed below: GTNDAEDCCL SVTQKPIPGY IVRNFHYLLI KDGCRVPAVV FTTLRGRQLC APPDQPW VERIIQRLQR TSAKMKRRSS. It is sometimes possible for the material contained within the vial of "CCL19, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.