CCL3 active protein

Human CCL3 (MIP-1alpha)

Cat. Num. AAA444016

• Gene Names: CCL3; MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha
• Purity: > 97% by SDS PAGE
• Synonyms: CCL3; Human CCL3 (MIP-1alpha); CCL3 (MIP-1alpha) Biotin; CCL3 active protein

• Host: E Coli derived
• Purity/Purification: > 97% by SDS PAGE
• Form/Format: Lyophilized
• Sequence Positions: 24-92
• Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWV QKYVSDLELSA
• Sequence Length: 92

• Reconstitution: Spin sample prior to reconstitution. Recommended at 100mug/mL in sterile water
• Carrier Protein: None
• Activity: EC50 = 0.1-0.3 nM determined by migration assay with cells expressing recombinant CCR5
• Extinction Coefficient: 10,010 M-1 cm-1
• Endotoxin Level: <0.01 EU per 1mug of the protein by the LAL method
• Modification: None
• UNSPSC Code: 12352202
• Preparation and Storage: Avoid repeated freeze-thaw cycles; 12 months from date of receipt, -20 to -70 degree C as supplied.; 1 month, 2 to 8 degree C under sterile conditions after reconstitution.; 3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

(Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1alpha. Responses are expressed as the % of total input cells.)

Related Product Information for CCL3 active protein

Macrophage inflammatory proteins 1-alpha (MIP-1alpha/CCL3) binds to cell surface receptors CCR1 and CCR5. It is a proinflammatory chemokine, leading to chemotaxis and activation of immune cells. It also inhibits proliferation of hematopoietic stem cells. Moreover, by binding to one of the HIV coreceptors, CCR5, it suppresses HIV infection.

References

1. "Macrophage inflammatory protein-1" Menten P., Wuyts A., Van Damme J. Cytokine Growth Factor Rev. 13:455-481(2002)
2. "Identification of RANTES, MIP-1, and MIP-1[1] as the major HIV-suppressive factors produced by CD8+T cells" Cocci F., De Vico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P. Science 270:1811-1815 (1995)
3. "Identification and characterization of an inhibitor of haemopoietic stem cell proliferation" Graham G.J., Wright E.G., Hewick R., Wolpe S.D., Wilkie N.M., Donaldson D., Lorimore S., Pragnell I.B. Nature 344:442-444 (1990)
4. "Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors" Zipfel P.F., Balke J., Irving S.G., Kelly K., Siebenlist U. J Immunol 142:1582-1590 (1989)

NCBI and Uniprot Product Information

• NCBI GI #: 4506843
• NCBI GeneID: 6348
• NCBI Accession #: NP_002974.1
• NCBI GenBank Nucleotide #: NM_002983.2
• UniProt Accession #: P10147
• Molecular Weight: Actual Molecular Mass: Mass spec data confirmed the expected mass of 7.716 kDa; Predicted Molecular Mass: 7.716 kDa
• NCBI Official Full Name: C-C motif chemokine 3
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 3
• NCBI Official Symbol: CCL3
• NCBI Official Synonym Symbols: MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha
• NCBI Protein Information: C-C motif chemokine 3; G0/G1 switch regulatory protein 19-1; PAT 464.1; SIS-beta; macrophage inflammatory protein 1-alpha; small inducible cytokine A3 (homologous to mouse Mip-1a); tonsillar lymphocyte LD78 alpha protein
• UniProt Protein Name: C-C motif chemokine 3
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL3
• UniProt Synonym Gene Names: MIP-1-alpha
• UniProt Entry Name: CCL3_HUMAN

NCBI Description

This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]

Uniprot Description

CCL3: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Chemokine; Secreted

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space; cytoplasm; extracellular region; intracellular; cytosol

Molecular Function: identical protein binding; protein binding; CCR1 chemokine receptor binding; chemokine activity; calcium-dependent protein kinase C activity; kinase activity; chemoattractant activity; phospholipase activator activity; protein kinase activity; CCR5 chemokine receptor binding

Biological Process: positive regulation of catalytic activity; negative regulation of osteoclast differentiation; exocytosis; behavior; response to toxin; positive regulation of calcium-mediated signaling; positive regulation of interleukin-1 beta secretion; chemotaxis; protein amino acid phosphorylation; negative regulation of bone mineralization; monocyte chemotaxis; regulation of cell shape; positive chemotaxis; cell-cell signaling; positive regulation of neuron apoptosis; calcium ion transport; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; inflammatory response; lymphocyte chemotaxis; neutrophil chemotaxis; calcium-mediated signaling; MAPKKK cascade; cytoskeleton organization and biogenesis; positive regulation of tumor necrosis factor production; release of sequestered calcium ion by sarcoplasmic reticulum into cytosol; macrophage chemotaxis; cellular calcium ion homeostasis; osteoblast differentiation; positive regulation of protein kinase B signaling cascade; cell activation; eosinophil chemotaxis; eosinophil degranulation; regulation of sensory perception of pain; positive regulation of calcium ion transport; astrocyte cell migration; positive regulation of inflammatory response; positive regulation of cell migration

Disease: Human Immunodeficiency Virus Type 1, Susceptibility To