CCL19 active protein

Human CCL19 (MIP-3beta)

Cat. Num. AAA444013

• Purity: > 97% by SDS PAGE
• Synonyms: CCL19; Human CCL19 (MIP-3beta); CCL19 (MIP-3beta) Biotin; CCL19 active protein

• Host: E Coli derived
• Purity/Purification: > 97% by SDS PAGE
• Form/Format: Lyophilized
• Sequence Positions: 22-98
• Sequence: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPW VERIIQRLQRTSAKMKRRSS

• Reconstitution: Spin sample prior to reconstitution. Recommended at 100mug/mL in sterile water
• Carrier Protein: None
• Activity: EC50 =7.2nM determined by migration assay with cells expressing recombinant CCR7
• Extinction Coefficient: 8,730 M-1 cm-1
• Endotoxin Level: <0.01 EU per 1mug of the protein by the LAL method
• Modification: None
• UNSPSC Code: 12352202
• Preparation and Storage: Avoid repeated freeze-thaw cycles; 12 months from date of receipt, -20 to -70 degree C as supplied.; 1 month, 2 to 8 degree C under sterile conditions after reconstitution.; 3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

(Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3beta. Responses are expressed as the % of total input cells.)

Related Product Information for CCL19 active protein

Macrophage inflammatory protein-3-beta (MIP3beta) (CCL19), also known as EBI1 ligand chemokine (ELC), directs chemotaxis of dendritic cells, and certain B- and T- lymphocytes, but not monocytes or granulocytes. It is constituitively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. Being a homeostatic chemokine, its primary physiological role is considered to be in the normal recirculation and homing of lymphocyte. However, MIP3beta could also be proinfammatory, and is implicated in the post-HIV infection responses.

References

1. "Molecular Cloning of a Novel Human CC Chemokine EBI1-ligand Chemokine That Is a Specific Functional Ligand for EBI1, CCR7" Yoshida R., Imai T., Hieshima K., Kusuda J., Baba M., Kitaura M., Nishimura M., Kakizaki M., Nomiyama H., Yoshie O.J Biol Chem 272:13803-13809 (1997)
2. "CK beta-11/macrophage inflammatory protein-3 beta/EBI1-ligand chemokine is an efficacious chemoattractant for T and B cells."Kim C.H., Pelus L.M., White J.R., Applebaum E., Johanson K., Broxmeyer H.E. J. Immunol. 160:2418-2424(1998)
3. "Homeostatic chemokines CCL19 and CCL21 promote inflammation in human immunodeficiency virus-infected patients with ongoing viral replication." Damås J.K., Landrø L., Fevang B., Heggelund L., Tjønnfjord G.E., Fløisand Y., Halvorsen B., Frøland S.S., Aukrust P. Clin Exp Immunol. 157:400-7 (2009)

NCBI and Uniprot Product Information

• UniProt Accession #: P99731
• Molecular Weight: Actual Molecular Mass: Mass Spec data confirmed expected mass of 8.800 kDa; Predicted Molecular Mass: 8.800 kDa
• Protein Family: C-C motif chemokine