Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Migration Assay: Cells expressing recombinant CXCR3 were assayed for migration through a transwell filter at various concentrations of WT IP-10. Responses are expressed as the % of total input cells.)

CXCL8 active protein

Human CXCL8 (IL-8)

Gene Names
CXCL8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1
Purity
> 97% by SDS PAGE
Synonyms
CXCL8; Human CXCL8 (IL-8); CXCL8 (IL-8)-Biotin; CXCL8 active protein
Ordering
For Research Use Only!
Host
E Coli derived
Purity/Purification
> 97% by SDS PAGE
Form/Format
Lyophilized
Sequence Positions
28-99
Sequence
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQ RVVEKFLKRAEN
Sequence Length
99
Reconstitution
Spin tube prior to resuspension. Recommended at 100mug/mL in sterile water
Carrier Protein
None
Activity
EC50 = 0.083 nM determined by migration assay with cells expressing recombinant CXCR1
Extinction Coefficient
7,450 M-1 cm-1
Endotoxin Level
0.01 EU per 1mug of the protein by the LAL method
Modification
None
UNSPSC Code
12352202
Preparation and Storage
Avoid repeated freeze-thaw cycles
12 months from date of receipt, -20 to -70 degree C as supplied.
1 month, 2 to 8 degree C under sterile conditions after reconstitution.
3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

(Migration Assay: Cells expressing recombinant CXCR3 were assayed for migration through a transwell filter at various concentrations of WT IP-10. Responses are expressed as the % of total input cells.)

Testing Data (Migration Assay: Cells expressing recombinant CXCR3 were assayed for migration through a transwell filter at various concentrations of WT IP-10. Responses are expressed as the % of total input cells.)
Related Product Information for CXCL8 active protein
Interleukin 8 (IL-8 /CXCL8) is secreted primarily by macrophages and monocytes. It is one of the key mediators for inflammatory responses. IL-8 is a strong chemotractant for neutrophils and monocytes promoting activation of these cells by binding to two cell surface receptors, CXCR1 and CXCR2. It is also a strong angiogenic agent and is considered to play a role in the pathogenesis of bronchiolitis.
References
1. "Interleukin-8, a chemotactic and inflammatory cytokine" Baggiolini M., Clark-Lewis I. FEBS Lett. 307:97-101(1992)
2. "Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction MDNCF mRNA by interleukin 1 and tumor necrosis factor" Matsushima K., Morishita K., Yoshimura T., Lavu S., Kobayashi Y., Lew W., Appella E., Kung H., Leonard E.J., Oppenheim J.J. J. Exp. Med. 167:1883-1893(1988)
3. "Chemokines, CXC|IL-8" Strieter R.M., Keane M.P., Belperio J. A. Encyclopedia of respiratory medicine, Academic Press, Oxford, P395-398(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Actual Molecular Mass: Mass spec data confirmed the expected mass of 8.386 kDa
Predicted Molecular Mass: 8.386 kDa
NCBI Official Full Name
interleukin-8
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 8
NCBI Official Symbol
CXCL8
NCBI Official Synonym Symbols
IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1
NCBI Protein Information
interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1
UniProt Protein Name
Interleukin-8
Protein Family
UniProt Gene Name
CXCL8
UniProt Synonym Gene Names
IL8; NAF
UniProt Entry Name
IL8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq, Jul 2008]

Uniprot Description

IL8: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. Belongs to the intercrine alpha (chemokine CxC) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Cytokine; Secreted

Chromosomal Location of Human Ortholog: 4q13-q21

Cellular Component: extracellular space; extracellular region

Molecular Function: protein binding; chemokine activity; interleukin-8 receptor binding

Biological Process: regulation of cell adhesion; neutrophil chemotaxis; neutrophil activation; negative regulation of G-protein coupled receptor protein signaling pathway; unfolded protein response; calcium-mediated signaling; signal transduction; chemotaxis; regulation of retroviral genome replication; induction of positive chemotaxis; G-protein coupled receptor protein signaling pathway; negative regulation of cell proliferation; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; response to molecule of bacterial origin; receptor internalization; immune response; angiogenesis; inflammatory response; cell cycle arrest; cell motility; embryonic gut development

Research Articles on CXCL8

Similar Products

Product Notes

The CXCL8 cxcl8 (Catalog #AAA444019) is an Active Protein produced from E Coli derived and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-99. The amino acid sequence is listed below: SAKELRCQCI KTYSKPFHPK FIKELRVIES GPHCANTEII VKLSDGRELC LDPKENWVQ RVVEKFLKRA EN. It is sometimes possible for the material contained within the vial of "CXCL8, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.