Rabbit anti-Mouse PDPK1 Polyclonal Antibody | anti-PDPK1 antibody

PDPK1 Antibody - N-terminal region

Cat. Num. AAA3223693

• Gene Names: Pdpk1; Pdk1
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: PDPK1; Polyclonal Antibody; PDPK1 Antibody - N-terminal region; anti-PDPK1 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: NPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAI
• Sequence Length: 559

• Applicable Applications for anti-PDPK1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse PDPK1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PDPK1Sample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-PDPK1 antibody

Serine/threonine kinase which acts as a master kinase, phosphorylating and activating a subgroup of the AGC family of protein kinases. Its targets include: protein kinase B (PKB/AKT1, PKB/AKT2, PKB/AKT3), p70 ribosomal protein S6 kinase (RPS6KB1), p90 ribosomal protein S6 kinase (RPS6KA1, RPS6KA2 and RPS6KA3), cyclic AMP-dependent protein kinase (PRKACA), protein kinase C (PRKCD and PRKCZ), serum and glucocorticoid-inducible kinase (SGK1, SGK2 and SGK3), p21-activated kinase-1 (PAK1), protein kinase PKN (PKN1 and PKN2). Plays a central role in the transduction of signals from insulin by providing the activating phosphorylation to PKB/AKT1, thus propagating the signal to downstream targets controlling cell proliferation and survival, as well as glucose and amino acid uptake and storage. Negatively regulates the TGF-beta-induced signaling by: modulating the association of SMAD3 and SMAD7 with TGF-beta receptor, phosphorylating SMAD2, SMAD3, SMAD4 and SMAD7, preventing the nuclear translocation of SMAD3 and SMAD4 and the translocation of SMAD7 from the nucleus to the cytoplasm in response to TGF-beta. Activates PPARG transcriptional activity and promotes adipocyte differentiation. Activates the NF-kappa-B pathway via phosphorylation of IKKB. The tyrosine phosphorylated form is crucial for the regulation of focal adhesions by angiotensin II. Controls proliferation, survival, and growth of developing pancreatic cells. Participates in the regulation of Ca2+ entry and Ca2+-activated K+ channels of mast cells. Essential for the motility of vascular endothelial cells (ECs) and is involved in the regulation of their chemotaxis. Plays a critical role in cardiac homeostasis by serving as a dual effector for cell survival and beta-adrenergic response. Plays an important role during thymocyte development by regulating the expression of key nutrient receptors on the surface of pre-T cells and mediating Notch-induced cell growth and proliferative responses. Provides negative feedback inhibition to toll-like receptor-mediated NF-kappa-B activation in macrophages.

Product Categories/Family for anti-PDPK1 antibody

Polyclonal; Lymphocyte Signaling; Protein Kinases; Signaling Intermediate; Developmental Biology; Signal Transduction; Apoptosis; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 124107594
• NCBI GeneID: 18607
• NCBI Accession #: NP_035192.2
• NCBI GenBank Nucleotide #: NM_011062.4
• UniProt Accession #: Q9Z2A0
• Molecular Weight: 61 kDa
• NCBI Official Full Name: 3-phosphoinositide-dependent protein kinase 1 isoform A
• NCBI Official Synonym Full Names: 3-phosphoinositide dependent protein kinase 1
• NCBI Official Symbol: Pdpk1
• NCBI Official Synonym Symbols: Pdk1
• NCBI Protein Information: 3-phosphoinositide-dependent protein kinase 1
• UniProt Protein Name: 3-phosphoinositide-dependent protein kinase 1
• Protein Family: 3-phosphoinositide-dependent protein kinase
• UniProt Gene Name: Pdpk1
• UniProt Synonym Gene Names: Pdk1; mPDK1
• UniProt Entry Name: PDPK1_MOUSE

Uniprot Description

PDK1: an AGC kinase of the PKB family that contains a PH domain. Involved in a wide variety of processes including cell proliferation, differentiation and apoptosis. Autophosphorylation in the activation loop is necessary for activity. Phosphorylates and activates kinases including Akt, PKC isozymes, p70 S6K and RSK. Three alternatively-spliced isoforms have been described.

Protein type: Nuclear receptor co-regulator; Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; Kinase, protein; AGC group; PKB family

Cellular Component: cell junction; cell projection; cytoplasm; cytoplasmic membrane-bound vesicle; cytosol; membrane; nucleus; perikaryon; plasma membrane

Molecular Function: 3-phosphoinositide-dependent protein kinase activity; ATP binding; insulin receptor binding; kinase activity; nucleotide binding; phospholipase activator activity; phospholipase binding; protein binding; protein kinase activity; protein kinase binding; protein serine/threonine kinase activity; transferase activity

Biological Process: activation of protein kinase B; calcium-mediated signaling; cell migration; cellular response to insulin stimulus; epidermal growth factor receptor signaling pathway; focal adhesion formation; hyperosmotic response; negative regulation of neuron apoptosis; negative regulation of protein kinase activity; negative regulation of toll-like receptor signaling pathway; negative regulation of transforming growth factor beta receptor signaling pathway; peptidyl-serine phosphorylation; peptidyl-threonine phosphorylation; phosphorylation; positive regulation of release of sequestered calcium ion into cytosol; protein amino acid phosphorylation; regulation of I-kappaB kinase/NF-kappaB cascade; regulation of mast cell degranulation; regulation of transcription, DNA-dependent; signal transduction; transcription, DNA-dependent