Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAPKAPK3Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MAPKAPK3 Polyclonal Antibody | anti-MAPKAPK3 antibody

MAPKAPK3 Antibody - C-terminal region

Gene Names
MAPKAPK3; 3PK; MK-3; MDPT3; MAPKAP3; MAPKAP-K3; MAPKAPK-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAPKAPK3; Polyclonal Antibody; MAPKAPK3 Antibody - C-terminal region; anti-MAPKAPK3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGS
Sequence Length
382
Applicable Applications for anti-MAPKAPK3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MAPKAPK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAPKAPK3Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAPKAPK3Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAPKAPK3 antibody
This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation. Alternate splicing results in multiple transcript variants that encode the same protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
MAP kinase-activated protein kinase 3
NCBI Official Synonym Full Names
mitogen-activated protein kinase-activated protein kinase 3
NCBI Official Symbol
MAPKAPK3
NCBI Official Synonym Symbols
3PK; MK-3; MDPT3; MAPKAP3; MAPKAP-K3; MAPKAPK-3
NCBI Protein Information
MAP kinase-activated protein kinase 3
UniProt Protein Name
MAP kinase-activated protein kinase 3
UniProt Gene Name
MAPKAPK3
UniProt Synonym Gene Names
MAPK-activated protein kinase 3; MAPKAP kinase 3; MAPKAP-K3; MAPKAPK-3; MK-3; 3pK
UniProt Entry Name
MAPK3_HUMAN

NCBI Description

This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011]

Uniprot Description

MAPKAPK3: a member of the MAPKAPK family of protein kinases. Activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation.

Protein type: Kinase, protein; Protein kinase, CAMK; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); CAMK group; MAPKAPK family; MAPKAPK subfamily

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: nucleoplasm; nuclear membrane; cytoplasm; nucleus; cytosol

Molecular Function: MAP kinase kinase activity; protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: nerve growth factor receptor signaling pathway; activation of MAPK activity; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; response to lipopolysaccharide; toll-like receptor 3 signaling pathway; signal transduction; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; peptidyl-serine phosphorylation; response to cytokine stimulus; Ras protein signal transduction; toll-like receptor signaling pathway; innate immune response; response to stress; toll-like receptor 9 signaling pathway; vascular endothelial growth factor receptor signaling pathway; toll-like receptor 4 signaling pathway

Research Articles on MAPKAPK3

Similar Products

Product Notes

The MAPKAPK3 mapkapk3 (Catalog #AAA3221833) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPKAPK3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPKAPK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPKAPK3 mapkapk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDKDHWDEVK EEMTSALATM RVDYDQVKIK DLKTSNNRLL NKRRKKQAGS. It is sometimes possible for the material contained within the vial of "MAPKAPK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.