Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SPHK1Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SPHK1 Polyclonal Antibody | anti-SPHK1 antibody

SPHK1 Antibody - middle region

Gene Names
SPHK1; SPHK
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SPHK1; Polyclonal Antibody; SPHK1 Antibody - middle region; anti-SPHK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNE
Sequence Length
384
Applicable Applications for anti-SPHK1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SPHK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SPHK1Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SPHK1Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SPHK1 antibody
The protein encoded by this gene catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (S1P), a lipid mediator with both intra- and extracellular functions. Intracellularly, S1P regulates proliferation and survival, and extracellularly, it is a ligand for cell surface G protein-coupled receptors. This protein, and its product S1P, play a key role in TNF-alpha signaling and the NF-kappa-B activation pathway important in inflammatory, antiapoptotic, and immune processes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
sphingosine kinase 1 isoform 3
NCBI Official Synonym Full Names
sphingosine kinase 1
NCBI Official Symbol
SPHK1
NCBI Official Synonym Symbols
SPHK
NCBI Protein Information
sphingosine kinase 1
UniProt Protein Name
Sphingosine kinase 1
UniProt Gene Name
SPHK1
UniProt Synonym Gene Names
SPHK; SPK; SK 1; SPK 1
UniProt Entry Name
SPHK1_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (S1P), a lipid mediator with both intra- and extracellular functions. Intracellularly, S1P regulates proliferation and survival, and extracellularly, it is a ligand for cell surface G protein-coupled receptors. This protein, and its product S1P, play a key role in TNF-alpha signaling and the NF-kappa-B activation pathway important in inflammatory, antiapoptotic, and immune processes. Phosphorylation of this protein alters its catalytic activity and promotes its translocation to the plasma membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2017]

Uniprot Description

SPHK1: Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-sphingosine and to a lesser extent sphinganine, but not other lipids, such as D,L-threo-dihydrosphingosine, N,N-dimethylsphingosine, diacylglycerol, ceramide, or phosphatidylinositol. Interacts with ACY1. Binds to calmodulin. Interacts with SPHKAP. Widely expressed with highest levels in adult liver, kidney, heart and skeletal muscle. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - sphingolipid; EC 2.7.1.91; Kinase, lipid

Chromosomal Location of Human Ortholog: 17q25.2

Cellular Component: synaptic vesicle; axon; cytoplasm; plasma membrane; nucleus; cytosol

Molecular Function: D-erythro-sphingosine kinase activity; calmodulin binding; protein binding; DNA binding; protein phosphatase 2A binding; sphinganine kinase activity; magnesium ion binding; diacylglycerol kinase activity; ATP binding; NAD+ kinase activity

Biological Process: protein folding; positive regulation of NF-kappaB import into nucleus; female pregnancy; positive regulation of mitotic cell cycle; signal transduction; positive regulation of neurotransmitter secretion; activation of NF-kappaB transcription factor; 'de novo' posttranslational protein folding; response to magnesium ion; positive regulation of fibroblast proliferation; regulation of interleukin-1 beta production; protein kinase C activation; positive regulation of smooth muscle contraction; inflammatory response; blood vessel development; sphingolipid metabolic process; sphingolipid biosynthetic process; cyclooxygenase pathway; calcium-mediated signaling; sphingosine metabolic process; cellular response to starvation; lipid phosphorylation; positive regulation of cell growth; response to ATP; positive regulation of angiogenesis; cellular protein metabolic process; positive regulation of protein ubiquitination; brain development; positive regulation of protein amino acid phosphorylation; response to progesterone stimulus; vascular endothelial growth factor receptor signaling pathway; sphingoid catabolic process; negative regulation of apoptosis; positive regulation of cell migration; response to amine stimulus

Research Articles on SPHK1

Similar Products

Product Notes

The SPHK1 sphk1 (Catalog #AAA3223213) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPHK1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPHK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPHK1 sphk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMHEVVNGLM ERPDWETAIQ KPLCSLPAGS GNALAASLNH YAGYEQVTNE. It is sometimes possible for the material contained within the vial of "SPHK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.