Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAP4K3Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MAP4K3 Polyclonal Antibody | anti-MAP4K3 antibody

MAP4K3 Antibody - middle region

Gene Names
MAP4K3; GLK; MEKKK3; MEKKK 3; MAPKKKK3; RAB8IPL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAP4K3; Polyclonal Antibody; MAP4K3 Antibody - middle region; anti-MAP4K3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAEKLLQHPFVTQHLTRSLAIELLDKVNNPDHSTYHDFDDDDPEPLVAVP
Sequence Length
894
Applicable Applications for anti-MAP4K3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAP4K3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAP4K3Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAP4K3Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAP4K3 antibody
This gene encodes a member of the mitogen-activated protein kinase kinase kinase kinase family. The encoded protein activates key effectors in cell signalling, among them c-Jun. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101 kDa
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase kinase 3 isoform 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase kinase 3
NCBI Official Symbol
MAP4K3
NCBI Official Synonym Symbols
GLK; MEKKK3; MEKKK 3; MAPKKKK3; RAB8IPL1
NCBI Protein Information
mitogen-activated protein kinase kinase kinase kinase 3
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase kinase 3
UniProt Gene Name
MAP4K3
UniProt Synonym Gene Names
RAB8IPL1; GLK; MEK kinase kinase 3; MEKKK 3
UniProt Entry Name
M4K3_HUMAN

NCBI Description

This gene encodes a member of the mitogen-activated protein kinase kinase kinase kinase family. The encoded protein activates key effectors in cell signalling, among them c-Jun. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

KHS2: an ubiquitous protein kinase of the STE20 family. May play a role in the response to environmental stress. Regulated by amino acids and acts upstream of mTORC1 and JNK. Required for maximal S6K and 4E-BP1 phosphorylation. Interacts with PPP2R5E, a regulatory subunit of PP2A. Following amino acid withdrawal, pS170 is dephosphorylated via PP2A. The dephosphorylation of pS170 by PP2A in response to amino acid restriction inhibits mTORC1 signaling. The inhibition of PPP2R5E expression prevents the dephosphorylation of KHS2 pS170, impairing mTORC1 inhibition during amino acid withdrawal. Three alternatively spliced isoforms have been described.

Protein type: Protein kinase, STE; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; STE group; STE20 family; KHS subfamily

Chromosomal Location of Human Ortholog: 2p22.1

Cellular Component: cytoplasm

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding; protein kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: regulation of catalytic activity; JNK cascade; protein amino acid phosphorylation; response to UV

Research Articles on MAP4K3

Similar Products

Product Notes

The MAP4K3 map4k3 (Catalog #AAA3220457) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP4K3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP4K3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAP4K3 map4k3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAEKLLQHPF VTQHLTRSLA IELLDKVNNP DHSTYHDFDD DDPEPLVAVP. It is sometimes possible for the material contained within the vial of "MAP4K3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.