Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TMEM64Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse TMEM64 Polyclonal Antibody | anti-TMEM64 antibody

TMEM64 Antibody - C-terminal region

Gene Names
Tmem64; AI790744; AV300874; 9630015D15Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM64; Polyclonal Antibody; TMEM64 Antibody - C-terminal region; anti-TMEM64 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HRAQVELNAAIVACEMELKTSLVKGNQSDPSGSSFYNKRTLTFSGGGINI
Sequence Length
381
Applicable Applications for anti-TMEM64 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse TMEM64
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TMEM64Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TMEM64Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TMEM64 antibody
Positively regulates TNFSF11-induced osteoclast differentiation. Acts as a regulator of TNFSF11-mediated Ca2+ signaling pathways via its interaction with SERCA2 which is critical for the TNFSF11-induced CREB1 activation and mitochondrial ROS generation necessary for proper osteoclast generation. Association between TMEM64 and SERCA2 in the ER leads to cytosolic Ca (2+) spiking for activation of NFATC1 and production of mitochondrial ROS, thereby triggering Ca (2+) signaling cascades that promote osteoclast differentiation and activation. Negatively regulates osteoblast differentiation and positively regulates adipocyte differentiation via modulation of the canonical Wnt signaling pathway. Mediates the switch in lineage commitment to osteogenesis rather than to adipogenesis in mesenchymal stem cells by negatively regulating the expression, activity and nuclear localization of CTNNB1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Full Name
transmembrane protein 64
NCBI Official Synonym Full Names
transmembrane protein 64
NCBI Official Symbol
Tmem64
NCBI Official Synonym Symbols
AI790744; AV300874; 9630015D15Rik
NCBI Protein Information
transmembrane protein 64
UniProt Protein Name
Transmembrane protein 64
Protein Family
UniProt Gene Name
Tmem64
UniProt Entry Name
TMM64_MOUSE

Research Articles on TMEM64

Similar Products

Product Notes

The TMEM64 tmem64 (Catalog #AAA3223839) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM64 Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM64 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEM64 tmem64 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HRAQVELNAA IVACEMELKT SLVKGNQSDP SGSSFYNKRT LTFSGGGINI. It is sometimes possible for the material contained within the vial of "TMEM64, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.