Western Blot (WB)
(Host: RabbitTarget Name: PDK1Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse PDK1 Polyclonal Antibody | anti-PDK1 antibody
PDK1 Antibody - middle region
Gene Names
Pdk1; B830012B01; D530020C15Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDK1; Polyclonal Antibody; PDK1 Antibody - middle region; anti-PDK1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QYFLDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEVI
Sequence Length
434
Applicable Applications for anti-PDK1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse PDK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PDK1Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PDK1Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDK1 antibody
Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Plays an important role in cellular responses to hypoxia and is important for cell proliferation under hypoxia. Protects cells against apoptosis in response to hypoxia and oxidative stress (By similarity).
Product Categories/Family for anti-PDK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47 kDa
NCBI Official Full Name
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial isoform 1
NCBI Official Synonym Full Names
pyruvate dehydrogenase kinase, isoenzyme 1
NCBI Official Symbol
Pdk1
NCBI Official Synonym Symbols
B830012B01; D530020C15Rik
NCBI Protein Information
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial; pyruvate dehydrogenase kinase, isozyme 1
UniProt Protein Name
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial
Protein Family
UniProt Gene Name
Pdk1
UniProt Entry Name
PDK1_MOUSE
Research Articles on PDK1
Similar Products
Product Notes
The PDK1 pdk1 (Catalog #AAA3223562) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDK1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PDK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDK1 pdk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QYFLDRFYMS RISIRMLLNQ HSLLFGGKGS PSHRKHIGSI NPNCDVVEVI. It is sometimes possible for the material contained within the vial of "PDK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
