Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RPS6KA1Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RPS6KA1 Polyclonal Antibody | anti-RPS6KA1 antibody

RPS6KA1 Antibody - middle region

Gene Names
RPS6KA1; RSK; HU-1; RSK1; p90Rsk; MAPKAPK1A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RPS6KA1; Polyclonal Antibody; RPS6KA1 Antibody - middle region; anti-RPS6KA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPF
Sequence Length
643
Applicable Applications for anti-RPS6KA1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RPS6KA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RPS6KA1Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RPS6KA1Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RPS6KA1 antibody
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70 kDa
NCBI Official Full Name
ribosomal protein S6 kinase alpha-1 isoform b
NCBI Official Synonym Full Names
ribosomal protein S6 kinase A1
NCBI Official Symbol
RPS6KA1
NCBI Official Synonym Symbols
RSK; HU-1; RSK1; p90Rsk; MAPKAPK1A
NCBI Protein Information
ribosomal protein S6 kinase alpha-1
UniProt Protein Name
Ribosomal protein S6 kinase alpha-1
UniProt Gene Name
RPS6KA1
UniProt Synonym Gene Names
MAPKAPK1A; RSK1; S6K-alpha-1; p90-RSK 1; p90RSK1; p90S6K; MAPK-activated protein kinase 1a; MAPKAP kinase 1a; MAPKAPK-1a; RSK-1
UniProt Entry Name
KS6A1_HUMAN

NCBI Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

p90RSK: an AGC kinase of the RSK family. Phosphorylated and activated by Erk1 and -2 in response to many growth factors, polypeptide hormones and neurotransmitters. Several phosphorylation sites are important for its activation. Possesses two kinase domains connected by a regulator linker region. Phosphorylates a wide range of substrates including ribosomal protein S6. Prominently expressed in brain structures essential for cognitive function and learning.

Protein type: EC 2.7.11.1; Protein kinase, AGC; Kinase, protein; Translation; Protein kinase, Ser/Thr (non-receptor); AGC group; RSK family; RSK subfamily

Chromosomal Location of Human Ortholog: 1p

Cellular Component: nucleoplasm; cytoplasm; spindle; cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; caspase inhibitor activity; magnesium ion binding; protein serine/threonine/tyrosine kinase activity; ATP binding

Biological Process: regulation of transcription in response to stress; axon guidance; nerve growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; regulation of translation in response to stress; negative regulation of caspase activity; toll-like receptor 3 signaling pathway; signal transduction; cell cycle; positive regulation of cell growth; protein amino acid phosphorylation; toll-like receptor 10 signaling pathway; toll-like receptor 2 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; synaptic transmission; toll-like receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; positive regulation of cell differentiation; toll-like receptor 4 signaling pathway; negative regulation of apoptosis

Research Articles on RPS6KA1

Similar Products

Product Notes

The RPS6KA1 rps6ka1 (Catalog #AAA3222345) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPS6KA1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPS6KA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPS6KA1 rps6ka1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQSLLRALFK RNPANRLGSG PDGAEEIKRH VFYSTIDWNK LYRREIKPPF. It is sometimes possible for the material contained within the vial of "RPS6KA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.