Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DRAXINSample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit DRAXIN Polyclonal Antibody | anti-DRAXIN antibody

DRAXIN Antibody - C-terminal region

Gene Names
DRAXIN; UNQ3119; neucrin; AGPA3119; C1orf187
Reactivity
Cow, Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DRAXIN; Polyclonal Antibody; DRAXIN Antibody - C-terminal region; anti-DRAXIN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDH
Sequence Length
349
Applicable Applications for anti-DRAXIN antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Horse: 100%; Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DRAXIN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DRAXINSample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DRAXINSample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DRAXIN antibody
This is a rabbit polyclonal antibody against DRAXIN. It was validated on Western Blot

Target Description: DRAXIN is a chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. It acts as a chemorepulsive guidance protein for commissural axons during development and is able to inhibit or repel neurite outgrowth from dorsal spinal cord. DRAXIN inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway.
Product Categories/Family for anti-DRAXIN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
draxin
NCBI Official Synonym Full Names
dorsal inhibitory axon guidance protein
NCBI Official Symbol
DRAXIN
NCBI Official Synonym Symbols
UNQ3119; neucrin; AGPA3119; C1orf187
NCBI Protein Information
draxin
UniProt Protein Name
Draxin
Protein Family
UniProt Gene Name
DRAXIN
UniProt Entry Name
DRAXI_HUMAN

Uniprot Description

DRAXIN: Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord. Inhibits the stabilization of cytosolic beta- catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway. Belongs to the draxin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: extracellular region

Biological Process: dorsal spinal cord development; axon guidance; Wnt receptor signaling pathway; forebrain development; commissural neuron differentiation in the spinal cord; negative regulation of neuron apoptosis; negative regulation of axon extension

Research Articles on DRAXIN

Similar Products

Product Notes

The DRAXIN draxin (Catalog #AAA3218267) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DRAXIN Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's DRAXIN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DRAXIN draxin for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLDMALFDWT DYEDLKPDGW PSAKKKEKHR GKLSSDGNET SPAEGEPCDH. It is sometimes possible for the material contained within the vial of "DRAXIN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.