Western Blot (WB)
(Host: RabbitTarget Name: JARID2Sample Type: 721_BAntibody Dilution: 1.0ug/mlJARID2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Rabbit JARID2 Polyclonal Antibody | anti-JARID2 antibody
JARID2 antibody - N-terminal region
Gene Names
JARID2; JMJ
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
JARID2; Polyclonal Antibody; JARID2 antibody - N-terminal region; anti-JARID2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ
Sequence Length
1246
Applicable Applications for anti-JARID2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human JARID2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: JARID2Sample Type: 721_BAntibody Dilution: 1.0ug/mlJARID2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Western Blot (WB)
(Host: RabbitTarget Name: JARID2Sample Type: 721_BAntibody Dilution: 1.0ug/mlJARID2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-JARID2 antibody
This is a rabbit polyclonal antibody against JARID2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a
Target Description: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a
Product Categories/Family for anti-JARID2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
139kDa
NCBI Official Full Name
protein Jumonji isoform 1
NCBI Official Synonym Full Names
jumonji and AT-rich interaction domain containing 2
NCBI Official Symbol
JARID2
NCBI Official Synonym Symbols
JMJ
NCBI Protein Information
protein Jumonji
UniProt Protein Name
Protein Jumonji
UniProt Gene Name
JARID2
UniProt Synonym Gene Names
JMJ
UniProt Entry Name
JARD2_HUMAN
NCBI Description
This gene encodes a Jumonji- and AT-rich interaction domain (ARID)-domain-containing protein. The encoded protein is a DNA-binding protein that functions as a transcriptional repressor. This protein interacts with the Polycomb repressive complex 2 (PRC2) which plays an essential role in regulating gene expression during embryonic development. This protein facilitates the recruitment of the PRC2 complex to target genes. Alternate splicing results in multiple transcript variants. Mutations in this gene are associated with chronic myeloid malignancies. [provided by RefSeq, May 2012]
Research Articles on JARID2
Similar Products
Product Notes
The JARID2 jarid2 (Catalog #AAA3214075) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JARID2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's JARID2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the JARID2 jarid2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: THKHVHNGHV FNGSSRSTRE KEPVQKHKSK EATPAKEKHS DHRADSRREQ. It is sometimes possible for the material contained within the vial of "JARID2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
