Mouse anti-Human EBNA2 Monoclonal Antibody | anti-EBNA2 antibody

Mouse monoclonal antibody Anti-Human EBNA2

Cat. Num. AAA120476

• Gene Names: SND1; p100; TDRD11
• Reactivity: Human
• Applications: Western Blot
• Synonyms: EBNA2; Monoclonal Antibody; Mouse monoclonal antibody Anti-Human EBNA2; Homo sapiens EBNA-2 co-activator (100kD) mRNA; complete cds.; anti-EBNA2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1
• Clone Number: 287C1a
• Form/Format: Mouse monoclonal anti-human EBNA2 Antibody in PBS (3.0 mM KCl, 1.5 mM KH2PO4, 140 mM NaCl, 8.0 mM Na2HPO4 (pH 7.4)) containing 1% bovine serum albumin (BSA) and 0.05% sodium azide (NaN3).
• Sequence: GKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVT
• Sequence Length: 2733

• Applicable Applications for anti-EBNA2 antibody: Western Blot
• Immunogen: EBNA2 Recombinant protein
• Preparation: This antibody was purified using protein G column chromatography from culture supernatant of hybridoma cultured in a medium containing bovine IgG-depleted (approximately 95%) fetal bovine serum.
• Sterility: Filtered through a 0.22 um membrane.
• Disposal: This antibody solution contains sodium azide (NaN3) as a preservative. There is a potential hazard that NaN3 reacts with copper or lead to produce an explosive compound. For safe disposal, the vial has to be washed thoroughly with water.
• Safety warnings and precautions: Caution must be taken to avoid contact with skin or eyes. In such a case, rinse thoroughly at once with water. Do not ingest, inhale, or swallow. Seek medical attention immediately. Wear appropriate protective clothing such as laboratory overalls, safety glasses and gloves. It is strongly advised that this product should be handled by people who have been well trained in laboratory techniques and that it is handled with care pursuant to the principles of good laboratory practice. All chemicals are deemed potentially harmful.; The vial is prone to fall over. Use caution, especially when the lid is off.
• Preparation and Storage: Store at 2-8 C for up to one year.; We recommend storing at –20 C for long-term storage.; Avoid repeat freezing and thawing cycles.

Quality Control

(Western blot analysis of immunized recombinant protein, using anti-EBNA2 monoclonal antibody. )

Quality Control #2

(Arrow indicates the region of immunized recombinant protein carrying 50-200 amino acids.)

NCBI and Uniprot Product Information

• NCBI GI #: 32879912
• NCBI GeneID: 27044
• Molecular Weight: 101,997 Da
• NCBI Official Full Name: Homo sapiens EBNA-2 co-activator (100kD) mRNA, complete cds
• NCBI Official Synonym Full Names: staphylococcal nuclease and tudor domain containing 1
• NCBI Official Symbol: SND1
• NCBI Official Synonym Symbols: p100; TDRD11
• NCBI Protein Information: staphylococcal nuclease domain-containing protein 1; 100 kDa coactivator; EBNA-2 co-activator (100kD); EBNA2 coactivator p100; SND1-BRAF fusion; Tudor-SN; p100 EBNA2 co-activator; p100 co-activator; staphylococcal nuclease domain containing 1; tudor domain-containing protein 11
• UniProt Protein Name: Staphylococcal nuclease domain-containing protein 1
• Protein Family: Epstein-Barr nuclear antigen
• UniProt Gene Name: SND1
• UniProt Entry Name: SND1_HUMAN

Uniprot Description

SND1: a transcriptional coactivator for STAT6. May function as a bridging factor between STAT6 and the basal transcription machinery.

Protein type: Transcription, coactivator/corepressor; RNA-binding

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: mitochondrion; membrane; cytoplasm; melanosome; nucleus

Molecular Function: protein binding; nuclease activity; transcription cofactor activity

Biological Process: osteoblast differentiation; viral reproduction; transcription, DNA-dependent; regulation of transcription, DNA-dependent; RNA-mediated gene silencing