CCL27 active protein

Human CCL27 (CTACK)

Cat. Num. AAA444008

• Gene Names: CCL27; ALP; ILC; CTAK; CTACK; PESKY; ESKINE; SCYA27
• Purity: > 97% by SDS PAGE
• Synonyms: CCL27; Human CCL27 (CTACK); CCL27 (CTACK); CCL27 active protein

• Host: E Coli derived
• Purity/Purification: > 97% by SDS PAGE
• Form/Format: Lyophilized
• Sequence Positions: 25-112
• Sequence: FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP SLSQWFEHQERKLHGTLPKLNFGMLRKMG
• Sequence Length: 112

• Reconstitution: Spin sample prior to reconstitution. Recommended at 100mug/mL in sterile water
• Carrier Protein: None
• Activity: EC50 = 34nM determined by migration assay with cells expressing recombinant CCR10
• Extinction Coefficient: 7,450 M-1 cm-1
• Endotoxin Level: <0.01 EU per 1mug of the protein by the LAL method
• Modification: None
• UNSPSC Code: 12352202
• Preparation and Storage: Avoid repeated freeze-thaw cycles; 12 months from date of receipt, -20 to -70 degree C as supplied.; 1 month, 2 to 8 degree C under sterile conditions after reconstitution.; 3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

Related Product Information for CCL27 active protein

Cutaneous T-cell-attracting chemokine (CTACK/CCL27) is a ligand for cell surface receptor CCR10. It is responsible for chemotaxis of skin-homing memory T cells during cutaneous inflammation. Interestingly, after CCR10-mediated internalization, CTACK, as well as a non-secreted splice variant of the same gene, can reach the nucleus and modulate transcription and cell behavior.

References

1. CCL27-CCR10 interactions regulate T cell-mediated skin inflammation. Homey et al. Nature Med. 8: 157-165 (2002)
2. Molecular cloning of a novel CC chemokine, interleukin-11 receptor alpha-locus chemokine (ILC), which is located on chromosome 9p13 and a potential homologue of a CC chemokine encoded by molluscum contagiosum virus. Ishikawa-Mochizuki et al. FEBS Lett. 460:544-548 (1999)
3. The Chemokine ESkine/CCL27 Displays Novel Modes of Intracrine and Paracrine Function. Gortz A. et al. J Immunol. 169:1387-1394 (2002)

NCBI and Uniprot Product Information

• NCBI GI #: 5730035
• NCBI GeneID: 10850
• NCBI Accession #: NP_006655.1
• NCBI GenBank Nucleotide #: NM_006664.3
• UniProt Accession #: Q9Y4X3
• Molecular Weight: Actual Molecular Mass: Mass Spec data confirmed expected mass of 10.149kDa; Predicted Molecular Mass: 10.149 kDa
• NCBI Official Full Name: C-C motif chemokine 27
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 27
• NCBI Official Symbol: CCL27
• NCBI Official Synonym Symbols: ALP; ILC; CTAK; CTACK; PESKY; ESKINE; SCYA27
• NCBI Protein Information: C-C motif chemokine 27; CC chemokine ILC; IL-11 R-alpha-locus chemokine; IL-11 Ralpha-locus chemokine; cutaneous T-cell attracting chemokine; cutaneous T-cell-attracting chemokine; skinkine; small inducible cytokine subfamily A (Cys-Cys), member 27; small-inducible cytokine A27
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL27
• UniProt Synonym Gene Names: ILC; SCYA27; CTACK
• UniProt Entry Name: CCL27_HUMAN

NCBI Description

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq, Sep 2014]

Uniprot Description

CCL27: Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Chemokine; Secreted

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: extracellular space; extracellular region

Molecular Function: chemokine activity

Biological Process: cell-cell signaling; immune response; chemotaxis