Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

CXCL12/SDF-1alpha active protein

Human CXCL12 (SDF-1alpha)

Gene Names
CXCL12; IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12
Purity
> 97% by SDS PAGE
Synonyms
CXCL12/SDF-1alpha; Human CXCL12 (SDF-1alpha); CXCL12/SDF-1alpha Biotin; CXCL12/SDF-1alpha active protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli derived
Purity/Purification
> 97% by SDS PAGE
Form/Format
Lyophilized
Sequence Positions
24-89
Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWI QEYLEKALNK
Sequence Length
93
Reconstitution
Spin tube prior to resuspension. Recommended at 100mug/mL in sterile water
Carrier Protein
None
Activity
EC50 = 0.1-0.25nM determined by migration assay with cells expressing recombinant CXCR4
Extinction Coefficient
8,730 M-1 cm-1
Endotoxin Level
<0.01 EU per 1mug of the protein by the LAL method
Modification
None
UNSPSC Code
12352202
Preparation and Storage
Avoid repeated freeze-thaw cycles
12 months from date of receipt, -20 to -70 degree C as supplied.
1 month, 2 to 8 degree C under sterile conditions after reconstitution.
3 months, -20 to -70 degree C under sterile conditions after reconstitution.

Testing Data

(Migration Assay: Jurkat cells expressing endogenous CXCR4 were assayed for migration through a transwell filter at various concentrations of WT SDF-1alpha. Responses are expressed as the % of total input cells )

Related Product Information for CXCL12/SDF-1alpha active protein
Stromal-Cell Derived Factor-1alpha (SDF-1alpha) (CXCL12) attracts lymphocytes and plays important roles in embryogenesis and angiogenesis with implications in tumor metastasis. By binding to CXCR4, one of the co-receptors for HIV viral entry, SDF-1alpha can suppress HIV. Besides CXCR4, SDF-1alpha also binds to the "decoy" receptor CXCR7, and activates the downstream beta-arrestin- rather than G protein-mediated signaling pathway.
References
1. "A highly efficacious lymphocyte chemoattractant, stromal cell-derived factor 1 (SDF-1)." Bleul. C, Fuhlbrigge. R, Casasnovas, J, Aiuti. A, Springer, T. J. Exp. Med. 184 (3): 1101-9. (1996)
2. "The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry". Bleul. C, Farzan, M., Choe, H., Parolin C., Clark-Lewis I., Sodroski J. Nature 382 (6594): 829-833 (1996)
3. "Clinical importance and therapeutic implications of the pivotal CXCL12-CXCR4 (chemokine ligand-receptor) interaction in cancer cell migration." Arya, M., Ahmed, H., Silhi, Williamson, M., Patel, H. Tumour Biol. 28 (3): 123-31 (2007)
4. "beta-arrestin- but not G protein -mediated signaling by the "decoy" receptor CXCR7." Rajagopal, S., Kim, J., Ahn, S., Craig, S., lam, C., Gerard, N., Gerard, C., Lefkowitz, R. Proc Natl Acad Sci USA 107(2):628-632 (2010)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Actual Molecular Mass: Mass Spec data confirmed expected mass of 7.98kDa
Predicted Molecular Mass: 7.963 kDa
NCBI Official Full Name
stromal cell-derived factor 1 isoform beta
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 12
NCBI Official Symbol
CXCL12
NCBI Official Synonym Symbols
IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12
NCBI Protein Information
stromal cell-derived factor 1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor
UniProt Protein Name
Stromal cell-derived factor 1
UniProt Gene Name
CXCL12
UniProt Synonym Gene Names
SDF1; SDF1A; SDF1B; SDF-1; hSDF-1; IRH; hIRH; PBSF
UniProt Entry Name
SDF1_HUMAN

NCBI Description

This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL12: Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to another C-X-C chemokine receptor CXCR7, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1- alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3- 67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and CXCR7, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T- cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of CXCR7 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Monomer or homodimer; in equilibrium. Dimer formation is induced by non acidic pH and the presence of multivalent anions, and by binding to CXCR4 or heparin. Monomeric form is required for full chemotactic activity and resistance to ischemia/reperfusion injury, whereas the dimeric form acts as a partial agonist of CXCR4, stimulating Ca2+ mobilization but with no chemotactic activity and instead acts as a selective antagonist that blocks chemotaxis induced by the monomeric form. Interacts with the N- terminus of CXCR7. Isoform Alpha and isoform Beta are ubiquitously expressed, with highest levels detected in liver, pancreas and spleen. Isoform Gamma is mainly expressed in heart, with weak expression detected in several other tissues. Isoform Delta, isoform Epsilon and isoform Theta have highest expression levels in pancreas, with lower levels detected in heart, kidney, liver and spleen. Belongs to the intercrine alpha (chemokine CxC) family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Cell development/differentiation; Chemokine; Secreted

Chromosomal Location of Human Ortholog: 10q11.1

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: growth factor activity; chemokine receptor binding; chemokine activity; CXCR chemokine receptor binding; receptor binding

Biological Process: response to peptide hormone stimulus; positive regulation of dopamine secretion; positive regulation of cell adhesion; adult locomotory behavior; blood circulation; neuron migration; motor axon guidance; signal transduction; chemotaxis; induction of positive chemotaxis; germ cell development; T cell proliferation; response to radiation; germ cell migration; cell adhesion; organ regeneration; regulation of actin polymerization and/or depolymerization; response to virus; cellular calcium ion homeostasis; patterning of blood vessels; G-protein coupled receptor protein signaling pathway; response to mechanical stimulus; response to heat; ameboidal cell migration; positive regulation of axon extension involved in axon guidance; response to hypoxia; immune response; positive regulation of endothelial cell proliferation; telencephalon cell migration

Disease: Human Immunodeficiency Virus Type 1, Susceptibility To

Research Articles on CXCL12/SDF-1alpha

Similar Products

Product Notes

The CXCL12/SDF-1alpha cxcl12 (Catalog #AAA444007) is an Active Protein produced from E Coli derived and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-89. The amino acid sequence is listed below: KPVSLSYRCP CRFFESHVAR ANVKHLKILN TPNCALQIVA RLKNNNRQVC IDPKLKWI QEYLEKALNK. It is sometimes possible for the material contained within the vial of "CXCL12/SDF-1alpha, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual