IL-7 Recombinant Protein | IL7 recombinant protein

Recombinant Human IL-7 Protein

Cat. Num. AAA9141874

• Gene Names: IL7; IL-7
• Purity: >90% by SDS-PAGE.
• Synonyms: IL-7; Recombinant Human IL-7 Protein; Interleukin-7; IL7 recombinant protein

• Host: HEK293 Cells
• Purity/Purification: >90% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
• Sequence Length: 115

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-7 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 30-35 kDa.)

Related Product Information for IL7 recombinant protein

Recombinant Human IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp26-His177) of human IL-7 (Accession #NP_000871.1) fused with a 6xHis tag at the C-terminus.

Product Categories/Family for IL7 recombinant protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 315467871
• NCBI GeneID: 3574
• NCBI Accession #: NP_001186817.1
• NCBI GenBank Nucleotide #: NP_001186817.1
• UniProt Accession #: P13232
• NCBI Official Full Name: interleukin-7 isoform 4
• NCBI Official Synonym Full Names: interleukin 7
• NCBI Official Symbol: IL7
• NCBI Official Synonym Symbols: IL-7
• NCBI Protein Information: interleukin-7
• UniProt Protein Name: Interleukin-7
• Protein Family: Interleukin
• UniProt Gene Name: IL7
• UniProt Synonym Gene Names: IL-7
• UniProt Entry Name: IL7_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout studies in mice suggested that this cytokine plays an essential role in lymphoid cell survival. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their presence in normal tissues has not been confirmed.[provided by RefSeq, Dec 2010]

Uniprot Description

IL7: Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Belongs to the IL-7/IL-9 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cell cycle regulation; Secreted, signal peptide; Apoptosis; Cell development/differentiation; Cytokine

Chromosomal Location of Human Ortholog: 8q12-q13

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-7 receptor binding; protein binding; growth factor activity; cytokine activity

Biological Process: positive regulation of organ growth; humoral immune response; T cell lineage commitment; organ morphogenesis; positive regulation of T cell differentiation; cell-cell signaling; regulation of gene expression; homeostasis of number of cells within a tissue; negative regulation of catalytic activity; positive regulation of cell proliferation; positive regulation of B cell proliferation; bone resorption; negative regulation of apoptosis