IGF1 active protein

Recombinant Human IGF1 Protein

Cat. Num. AAA9141727

• Gene Names: IGF1; IGF; MGF; IGFI; IGF-I
• Purity: >87% by SDS-PAGE.
• Synonyms: IGF1; Recombinant Human IGF1 Protein; IGF-1; IGF-I; IGF1A; IGFI; IGF?I; MGF; IGF1 active protein

• Host: HEK293 Cells
• Purity/Purification: >87% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Sequence Length: 195

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant human IGFBP6 at 1 ug/mL (100 uL/well) can bind recombinant human IGF1 with a linear range of 30-250 ng/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: Fc, 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IGF1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 41 kDa.)

Related Product Information for IGF1 active protein

Recombinant Human IGF1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly 49 - Ala 118) of human IGF1 (Accession #NP_001104755.1) fused with an Fc, 6xHis tag at the C-terminus.

Product Categories/Family for IGF1 active protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 163659903
• NCBI GeneID: 3479
• NCBI Accession #: NP_001104755.1
• NCBI GenBank Nucleotide #: NP_001104755.1
• UniProt Accession #: P05019
• NCBI Official Full Name: insulin-like growth factor I isoform 3 preproprotein
• NCBI Official Synonym Full Names: insulin like growth factor 1
• NCBI Official Symbol: IGF1
• NCBI Official Synonym Symbols: IGF; MGF; IGFI; IGF-I
• NCBI Protein Information: insulin-like growth factor I
• UniProt Protein Name: Insulin-like growth factor I
• Protein Family: Insulin-like growth factor
• UniProt Gene Name: IGF1
• UniProt Synonym Gene Names: IBP1; IGF-I; MGF
• UniProt Entry Name: IGF1_HUMAN

NCBI Description

The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]

Uniprot Description

IGF1: The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency). IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation. Belongs to the insulin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 12q23.2

Cellular Component: insulin-like growth factor binding protein complex; extracellular space; plasma membrane; extracellular region

Molecular Function: integrin binding; insulin-like growth factor receptor binding; protein binding; growth factor activity; hormone activity; insulin receptor binding

Biological Process: muscle development; positive regulation of transcription, DNA-dependent; chondroitin sulfate proteoglycan biosynthetic process; glycolate metabolic process; exocrine pancreas development; water homeostasis; positive regulation of glucose import; positive regulation of fibroblast proliferation; proteoglycan biosynthetic process; inner ear development; positive regulation of DNA binding; muscle hypertrophy; platelet activation; positive regulation of mitosis; positive regulation of protein import into nucleus, translocation; regulation of establishment and/or maintenance of cell polarity; positive regulation of phosphoinositide 3-kinase cascade; cell activation; positive regulation of peptidyl-tyrosine phosphorylation; branching morphogenesis of a tube; insulin-like growth factor receptor signaling pathway; regulation of gene expression; response to heat; positive regulation of transcription from RNA polymerase II promoter; alveolus development; positive regulation of epithelial cell proliferation; negative regulation of apoptosis; positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of smooth muscle cell proliferation; myoblast proliferation; positive regulation of glycogen biosynthetic process; positive regulation of activated T cell proliferation; positive regulation of smooth muscle cell migration; signal transduction; negative regulation of cell proliferation; glial cell differentiation; platelet degranulation; positive regulation of MAPKKK cascade; mammary gland development; positive regulation of cell proliferation; DNA replication; skeletal development; positive regulation of granule cell precursor proliferation; phosphoinositide-mediated signaling; multicellular organism growth; regulation of multicellular organism growth; myotube cell development; satellite cell compartment self-renewal involved in skeletal muscle regeneration; myoblast differentiation; positive regulation of osteoblast differentiation; cell proliferation; positive regulation of protein kinase B signaling cascade; cellular protein metabolic process; positive regulation of tyrosine phosphorylation of Stat5 protein; positive regulation of glycolysis; Ras protein signal transduction; blood vessel remodeling; positive regulation of Ras protein signal transduction; blood coagulation; cell motility; positive regulation of DNA replication

Disease: Insulin-like Growth Factor I Deficiency