Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse CXCL16 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-45kDa.)

CXCL16 recombinant protein

Recombinant Mouse CXCL16 Protein

Gene Names
Cxcl16; SR-PSOX; Zmynd15; AV290116; BB024863; CXCL16v1; CXCL16v2; b2b498Clo; 0910001K24Rik
Purity
>97% by SDS-PAGE.
Synonyms
CXCL16; Recombinant Mouse CXCL16 Protein; CXCLG16; SCYB16; SR-PSOX; CXCL16 recombinant protein
Ordering
For Research Use Only!
Host
HEK293
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAW
Sequence Length
246
Species
Mouse
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse CXCL16 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-45kDa.)

SDS-Page (Recombinant Mouse CXCL16 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 38-45kDa.)
Related Product Information for CXCL16 recombinant protein
Recombinant Mouse CXCL16 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asn27-Trp201) of mouse CXCL16 (Accession #NP_075647.3) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for CXCL16 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
C-X-C motif chemokine 16
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 16
NCBI Official Symbol
Cxcl16
NCBI Official Synonym Symbols
SR-PSOX; Zmynd15; AV290116; BB024863; CXCL16v1; CXCL16v2; b2b498Clo; 0910001K24Rik
NCBI Protein Information
C-X-C motif chemokine 16
UniProt Protein Name
C-X-C motif chemokine 16
Protein Family
UniProt Gene Name
Cxcl16
UniProt Synonym Gene Names
Srpsox; SR-PSOX
UniProt Entry Name
CXL16_MOUSE

Uniprot Description

CXCL16: Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Membrane protein, integral

Cellular Component: extracellular space; membrane; integral to membrane

Molecular Function: low-density lipoprotein receptor activity; chemokine activity; chemokine receptor binding; cytokine activity; scavenger receptor activity

Biological Process: receptor-mediated endocytosis; response to cytokine stimulus; chemotaxis; positive regulation of cell growth; lymphocyte chemotaxis; positive regulation of cell migration

Research Articles on CXCL16

Similar Products

Product Notes

The CXCL16 cxcl16 (Catalog #AAA9141891) is a Recombinant Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: NQGSVAGSCS CDRTISSGTQ IPQGTLDHIR KYLKAFHRCP FFIRFQLQSK SVCGGSQDQW VRELVDCFER KECGTGHGKS FHHQKHLPQA STQTPEAAEG TPSDTSTPAH SQSTQHSTLP SGALSLNKEH TQPWEMTTLP SGYGLEARPE AEANEKQQDD RQQEAPGAGA STPAW. It is sometimes possible for the material contained within the vial of "CXCL16, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.