Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse IL-7 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 16-25 kDa.)

IL-7 Recombinant Protein | Il7 recombinant protein

Recombinant Mouse IL-7 Protein

Gene Names
Il7; Il-7; hlb368; A630026I06Rik
Purity
>95% by SDS-PAGE.
Synonyms
IL-7; Recombinant Mouse IL-7 Protein; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF; Il7 recombinant protein
Ordering
For Research Use Only!
Host
Mammalian
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Sequence Length
154
Species
Mouse
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse IL-7 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 16-25 kDa.)

SDS-Page (Recombinant Mouse IL-7 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 16-25 kDa.)
Related Product Information for Il7 recombinant protein
Description: Recombinant Mouse IL-7 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Glu26-Ile154) of mouse IL-7 (Accession #P10168) fused with a 6xHis tag at the C-terminus.

Background: This protein is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms.
Product Categories/Family for Il7 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-7 isoform a
NCBI Official Synonym Full Names
interleukin 7
NCBI Official Symbol
Il7
NCBI Official Synonym Symbols
Il-7; hlb368; A630026I06Rik
NCBI Protein Information
interleukin-7
UniProt Protein Name
Interleukin-7
Protein Family
UniProt Gene Name
Il7
UniProt Synonym Gene Names
Il-7; IL-7
UniProt Entry Name
IL7_MOUSE

NCBI Description

The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]

Uniprot Description

IL7: Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Belongs to the IL-7/IL-9 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Secreted, signal peptide; Cell development/differentiation; Cytokine; Secreted; Apoptosis

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-7 receptor binding; growth factor activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine activity

Biological Process: organ morphogenesis; T cell lineage commitment; positive regulation of T cell differentiation; cell-cell signaling; regulation of gene expression; homeostasis of number of cells within a tissue; negative regulation of catalytic activity; positive regulation of B cell proliferation; immune response; positive regulation of organ growth; humoral immune response; bone resorption

Research Articles on Il7

Similar Products

Product Notes

The Il7 il7 (Catalog #AAA9141918) is a Recombinant Protein produced from Mammalian and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ECHIKDKEGK AYESVLMISI DELDKMTGTD SNCPNNEPNF FRKHVCDDTK EAAFLNRAAR KLKQFLKMNI SEEFNVHLLT VSQGTQTLVN CTSKEEKNVK EQKKNDACFL KRLLREIKTC WNKILKGSI. It is sometimes possible for the material contained within the vial of "IL-7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.