SDS-Page
(Recombinant Human CD14 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-55 kDa.)
CD14 recombinant protein
Recombinant Human CD14 Protein
Purity
>95% by SDS-PAGE.
Synonyms
CD14; Recombinant Human CD14 Protein; CD14 recombinant protein
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC
Sequence Length
375
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human CD14 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-55 kDa.)
SDS-Page
(Recombinant Human CD14 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-55 kDa.)
Related Product Information for CD14 recombinant protein
Recombinant Human CD14 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Cys352) of human CD14 (Accession #NP_000582.1) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for CD14 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
monocyte differentiation antigen CD14
NCBI Official Synonym Full Names
CD14 molecule
NCBI Official Symbol
CD14
NCBI Protein Information
monocyte differentiation antigen CD14
UniProt Protein Name
Monocyte differentiation antigen CD14
Protein Family
UniProt Gene Name
CD14
UniProt Entry Name
CD14_HUMAN
NCBI Description
The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Mar 2010]
Research Articles on CD14
Similar Products
Product Notes
The CD14 cd14 (Catalog #AAA9141851) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TTPEPCELDD EDFRCVCNFS EPQPDWSEAF QCVSAVEVEI HAGGLNLEPF LKRVDADADP RQYADTVKAL RVRRLTVGAA QVPAQLLVGA LRVLAYSRLK ELTLEDLKIT GTMPPLPLEA TGLALSSLRL RNVSWATGRS WLAELQQWLK PGLKVLSIAQ AHSPAFSCEQ VRAFPALTSL DLSDNPGLGE RGLMAALCPH KFPAIQNLAL RNTGMETPTG VCAALAAAGV QPHSLDLSHN SLRATVNPSA PRCMWSSALN SLNLSFAGLE QVPKGLPAKL RVLDLSCNRL NRAPQPDELP EVDNLTLDGN PFLVPGTALP HEGSMNSGVV PAC. It is sometimes possible for the material contained within the vial of "CD14, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
