Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse Flt-3 Ligand Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 56kDa.)

Flt-3 Ligand Recombinant Protein | FLT3L recombinant protein

Recombinant Mouse Flt-3 Ligand Protein

Gene Names
Flt3l; Ly72L; Flt3lg
Purity
>85% by SDS-PAGE.
Synonyms
Flt-3 Ligand; Recombinant Mouse Flt-3 Ligand Protein; FLT3LG; FL; Flt3 ligand; FLT3L recombinant protein
Ordering
For Research Use Only!
Host
HEK293
Purity/Purification
>85% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR
Sequence Length
232
Species
Mouse
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse Flt-3 Ligand Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 56kDa.)

SDS-Page (Recombinant Mouse Flt-3 Ligand Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 56kDa.)
Related Product Information for FLT3L recombinant protein
Recombinant Mouse Flt-3 Ligand Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Arg188) of mouse Flt-3 Ligand (Accession #NP_038548.3.) fused with an Fc, 6xHis tag at the C-terminus.
Product Categories/Family for FLT3L recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
fms-related tyrosine kinase 3 ligand
NCBI Official Synonym Full Names
FMS-like tyrosine kinase 3 ligand
NCBI Official Symbol
Flt3l
NCBI Official Synonym Symbols
Ly72L; Flt3lg
NCBI Protein Information
fms-related tyrosine kinase 3 ligand
UniProt Protein Name
Fms-related tyrosine kinase 3 ligand
UniProt Gene Name
Flt3lg
UniProt Synonym Gene Names
Flt3l; Flt3 ligand; Flt3L
UniProt Entry Name
FLT3L_MOUSE

Uniprot Description

FLT3LG: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Ligand, receptor tyrosine kinase; Membrane protein, integral

Cellular Component: cell surface; extracellular space

Molecular Function: protein homodimerization activity; receptor tyrosine kinase binding

Biological Process: embryonic hemopoiesis; homeostasis of number of cells within a tissue; lymphocyte differentiation; positive regulation of cell cycle; positive regulation of cell proliferation; positive regulation of myoblast differentiation; positive regulation of natural killer cell differentiation; positive regulation of protein amino acid phosphorylation; positive regulation of transcription from RNA polymerase II promoter; regulation of myeloid dendritic cell activation

Research Articles on FLT3L

Similar Products

Product Notes

The FLT3L flt3lg (Catalog #AAA9141888) is a Recombinant Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MTVLAPAWSP NSSLLLLLLL LSPCLRGTPD CYFSHSPISS NFKVKFRELT DHLLKDYPVT VAVNLQDEKH CKALWSLFLA QRWIEQLKTV AGSKMQTLLE DVNTEIHFVT SCTFQPLPEC LRFVQTNISH LLKDTCTQLL ALKPCIGKAC QNFSRCLEVQ CQPDSSTLLP PRSPIALEAT ELPEPRPR. It is sometimes possible for the material contained within the vial of "Flt-3 Ligand, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.