Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human ALK-7 Protein Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-60 kDa.)

ALK-7 recombinant protein

Recombinant Human ALK-7 Protein

Gene Names
ACVR1C; ALK7; ACVRLK7
Purity
>95% by SDS-PAGE.
Synonyms
ALK-7; Recombinant Human ALK-7 Protein; ACVRLK7; ALK7; ALK-7 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
Sequence Length
443
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human ALK-7 Protein Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-60 kDa.)

SDS-Page (Recombinant Human ALK-7 Protein Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-60 kDa.)
Related Product Information for ALK-7 recombinant protein
Recombinant Human ALK-7 Protein Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu22-Glu113) of human ALK-7 Protein (Accession #NP_660302.2) fused with an Fc, 6xHis tag at the C-terminus.
Product Categories/Family for ALK-7 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
activin receptor type-1C isoform 2
NCBI Official Synonym Full Names
activin A receptor type 1C
NCBI Official Symbol
ACVR1C
NCBI Official Synonym Symbols
ALK7; ACVRLK7
NCBI Protein Information
activin receptor type-1C
UniProt Protein Name
Activin receptor type-1C
UniProt Gene Name
ACVR1C
UniProt Synonym Gene Names
ALK7; ACTR-IC; ALK-7
UniProt Entry Name
ACV1C_HUMAN

NCBI Description

ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM, Mar 2008]

Uniprot Description

ALK7: Serine/threonine protein kinase which forms a receptor complex on ligand binding. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3. Receptor for activin AB, activin B and NODAL. Plays a role in cell differentiation, growth arrest and apoptosis. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TKL; Protein kinase, Ser/Thr (receptor); Membrane protein, integral; Kinase, protein; EC 2.7.11.30; TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 2q24.1

Cellular Component: plasma membrane; activin receptor complex

Molecular Function: transforming growth factor beta receptor activity; activin receptor activity, type I; growth factor binding; metal ion binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: response to dietary excess; sequestering of lipid; apoptotic nuclear changes; response to glucose stimulus; positive regulation of caspase activity; cell differentiation; protein amino acid phosphorylation; response to insulin stimulus; negative regulation of insulin secretion

Research Articles on ALK-7

Similar Products

Product Notes

The ALK-7 acvr1c (Catalog #AAA9141806) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LSPGLKCVCL LCDSSNFTCQ TEGACWASVM LTNGKEQVIK SCVSLPELNA QVFCHSSNNV TKTECCFTDF CNNITLHLPT ASPNAPKLGP ME. It is sometimes possible for the material contained within the vial of "ALK-7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.