SCF active protein

Recombinant Mouse SCF Protein

Cat. Num. AAA9141738

• Gene Names: Kitl; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted
• Purity: >95% by SDS-PAGE.
• Synonyms: SCF; Recombinant Mouse SCF Protein; KITLG; FPH2; KL-1; Kitl; MGF; SF; SHEP7; KL; SCF active protein

• Host: HEK293
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
• Sequence Length: 273

• Species: Mouse
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA.Immobilized recombinant Mouse SCF at 2 ug/mL (100 uL/well) can bind recombinant human CD117 with a linear range of 1.5-10ng/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse SCF Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18-38kDa.)

Related Product Information for SCF active protein

Recombinant Mouse SCF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys26-Ala189) of mouse SCF (Accession #NP_038626.1.) fused with a 6xHis tag at the C-terminus.

Product Categories/Family for SCF active protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 7305267
• NCBI GeneID: 17311
• NCBI Accession #: NP_038626.1
• NCBI GenBank Nucleotide #: NP_038626.1
• UniProt Accession #: P20826
• NCBI Official Full Name: kit ligand isoform 1
• NCBI Official Synonym Full Names: kit ligand
• NCBI Official Symbol: Kitl
• NCBI Official Synonym Symbols: Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted
• NCBI Protein Information: kit ligand
• UniProt Protein Name: Kit ligand
• Protein Family: SCF-associated factor
• UniProt Gene Name: Kitlg
• UniProt Synonym Gene Names: Kitl; Mgf; Sl; Slf; MGF; SCF; sKITLG
• UniProt Entry Name: SCF_MOUSE

Uniprot Description

SCF: Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5- trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. Homodimer, non-covalently linked (Probable). Heterotetramer with KIT, binding two KIT molecules; thereby mediates KIT dimerization and subsequent activation by autophosphorylation. Belongs to the SCF family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: extracellular space; cytoskeleton; membrane; cytoplasm; extracellular region; integral to membrane; plasma membrane

Molecular Function: protein binding; growth factor activity; cytokine activity; stem cell factor receptor binding

Biological Process: embryonic hemopoiesis; positive regulation of leukocyte migration; germ cell programmed cell death; germ cell development; positive regulation of MAP kinase activity; positive regulation of peptidyl-tyrosine phosphorylation; ovarian follicle development; negative regulation of mast cell apoptosis; positive regulation of melanocyte differentiation; positive regulation of cell proliferation; positive regulation of myeloid leukocyte differentiation; positive regulation of Ras protein signal transduction; cell adhesion; neural crest cell migration; positive regulation of DNA replication; negative regulation of apoptosis