Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PILRA antibody (MBS5302241) used at 0.5 ug/ml to detect target protein.)

Rabbit PILRA Polyclonal Antibody | anti-PILRA antibody

PILRA antibody

Gene Names
PILRA; FDF03
Applications
Western Blot
Purity
Affinity purified
Synonyms
PILRA; Polyclonal Antibody; PILRA antibody; Polyclonal PILRA; Anti-PILRA; Paired Immunoglobin-Like Type 2 Receptor Alpha; FDF03; anti-PILRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
PILRA antibody was raised against the N terminal of PILRA
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PILRA antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
226
Applicable Applications for anti-PILRA antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. This particular gene encodes the ITIM-bearing member of the receptor pair, which functions in the inhibitory role.
Cross-Reactivity
Human
Immunogen
PILRA antibody was raised using the N terminal of PILRA corresponding to a region with amino acids IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(PILRA antibody (MBS5302241) used at 0.5 ug/ml to detect target protein.)

Western Blot (WB) (PILRA antibody (MBS5302241) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-PILRA antibody
Rabbit polyclonal PILRA antibody raised against the N terminal of PILRA
Product Categories/Family for anti-PILRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
18 kDa (MW of target protein)
NCBI Official Full Name
PILRA protein
NCBI Official Synonym Full Names
paired immunoglobin-like type 2 receptor alpha
NCBI Official Symbol
PILRA
NCBI Official Synonym Symbols
FDF03
NCBI Protein Information
paired immunoglobulin-like type 2 receptor alpha
UniProt Protein Name
Paired immunoglobulin-like type 2 receptor alpha
UniProt Gene Name
PILRA
UniProt Entry Name
PILRA_HUMAN

NCBI Description

Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. These paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7. This particular gene encodes the ITIM-bearing member of the receptor pair, which functions in the inhibitory role. Alternative splicing has been observed at this locus and three variants, each encoding a distinct isoform, are described. [provided by RefSeq, Jul 2008]

Uniprot Description

PILRA: Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases like PTPN6/SHP-1 and PTPN11/SHP-2 via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. Receptor for PIANP. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: viral reproduction; signal transduction

Research Articles on PILRA

Similar Products

Product Notes

The PILRA pilra (Catalog #AAA5302241) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PILRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the PILRA pilra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PILRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.