Rabbit LRRC51 Polyclonal Antibody | anti-LRRC51 antibody

LRRC51 antibody

Cat. Num. AAA839889

• Gene Names: Lrrc51; Lrtomt; 1700008D07Rik
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: LRRC51; Polyclonal Antibody; LRRC51 antibody; Polyclonal LRRC51; Anti-LRRC51; LRRC-51; Leucine Rich Repeat Containing 51; LRRC 51; anti-LRRC51 antibody

• Host: Rabbit
• Clonality: Polyclonal
• Specificity: LRRC51 antibody was raised against the N terminal of LRRC51
• Purity/Purification: Affinity purified
• Form/Format: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC51 antibody in PBS
• Concentration: 1 mg/ml (varies by lot)
• Sequence Length: 192

• Applicable Applications for anti-LRRC51 antibody: Western Blot (WB)
• Application Notes: WB: 1 ug/ml
• Biological Significance: LRRC51 encodes two different proteins. One is a leucine-rich transmembrane protein of unknown function while the other is an O-methyltransferase. Defects in the O-methyltransferase protein can cause nonsyndromic deafness. Several transcript variants encoding different isoforms of each protein have been found for this gene, along with a transcript that is not thought to be protein-coding.
• Cross-Reactivity: Human
• Immunogen: LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL
• Preparation and Storage: Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(LRRC51 antibody (MBS839889) used at 1 ug/ml to detect target protein.)

Related Product Information for anti-LRRC51 antibody

Rabbit polyclonal LRRC51 antibody raised against the N terminal of LRRC51

Product Categories/Family for anti-LRRC51 antibody

Cell Biology; Purified Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 81917157
• NCBI GeneID: 69358
• Molecular Weight: 22 kDa (MW of target protein)
• NCBI Official Full Name: Leucine-rich repeat-containing protein 51
• NCBI Official Synonym Full Names: leucine rich repeat containing 51
• NCBI Official Symbol: Lrrc51
• NCBI Official Synonym Symbols: Lrtomt; 1700008D07Rik
• NCBI Protein Information: leucine-rich repeat-containing protein 51
• UniProt Protein Name: Leucine-rich repeat-containing protein 51
• Protein Family: Leucine-rich repeat-containing protein
• UniProt Gene Name: Lrrc51
• UniProt Synonym Gene Names: Lrtomt1
• UniProt Entry Name: LRC51_MOUSE

Uniprot Description

LRRC51: This gene includes two transcript forms. The short form has one open reading frame (ORF), which encodes the leucine-rich repeats (LRR)-containing protein of unknown function. This protein is called LRTOMT1 or LRRC51. The long form has two alternative ORFs; the upstream ORF has the same translation start codon as used in the short form and the resulting transcript is a candidate for nonsense-mediated decay, and the downstream ORF encodes a different protein, which is a transmembrane catechol-O-methyltransferase and is called LRTOMT2, TOMT or COMT2. The COMT2 is essential for auditory and vestibular function. Defects in the COMT2 can cause nonsyndromic deafness. Alternatively spliced transcript variants from each transcript form have been found for this gene. [provided by RefSeq, Sep 2012]

Protein type: Unknown function

Cellular Component: cytoplasm