Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Symplekin antibody (MBS5302519) used at 1 ug/ml to detect target protein.)

Rabbit Symplekin Polyclonal Antibody | anti-SYMPK antibody

Symplekin antibody

Gene Names
SYMPK; SPK; SYM
Applications
Western Blot
Purity
Affinity purified
Synonyms
Symplekin; Polyclonal Antibody; Symplekin antibody; Polyclonal Symplekin; Anti-Symplekin; FLJ27092; SYMPK; SPK; SYM; anti-SYMPK antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Symplekin antibody was raised against the middle region of SYMPK
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYMPK antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1274
Applicable Applications for anti-SYMPK antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.
Cross-Reactivity
Human
Immunogen
Symplekin antibody was raised using the middle region of SYMPK corresponding to a region with amino acids GPLPKETAAGGLTLKEERSPQTLAPVGEDAMKTPSPAAEDAREPEAKGNS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Symplekin antibody (MBS5302519) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Symplekin antibody (MBS5302519) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SYMPK antibody
Rabbit polyclonal Symplekin antibody raised against the middle region of SYMPK
Product Categories/Family for anti-SYMPK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
141 kDa (MW of target protein)
NCBI Official Full Name
symplekin
NCBI Official Synonym Full Names
symplekin
NCBI Official Symbol
SYMPK
NCBI Official Synonym Symbols
SPK; SYM
NCBI Protein Information
symplekin
UniProt Protein Name
Symplekin
Protein Family
UniProt Gene Name
SYMPK
UniProt Synonym Gene Names
SPK
UniProt Entry Name
SYMPK_HUMAN

NCBI Description

This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types. [provided by RefSeq, Jul 2008]

Uniprot Description

Symplekin: Heat-labile component of a multimolecular complex that function in histone mRNA 3'-end processing. Specific component of the tight junction (TJ) plaque, but might not be an exclusively junctional component. May have a house-keeping rule. May be required for pre-mRNA polyadenylation. Found in a heat-sensitive complex at least composed of several cleavage and polyadenylation specific and cleavage stimulation factors. Interacts with CPSF2, CPSF3 and CSTF2. Interacts with HSF1 in heat-stressed cells. In testis, expressed in polar epithelia and Sertoli cells but not in vascular endothelia. The protein is detected in stomach, duodenum, pancreas, liver, fetal brain, carcinomas, lens-forming cells, fibroblasts, lymphocytes, lymphoma cells, erythroleukemia cells but not in endothelium of vessels, epidermis, intercalated disks, Purkinje fiber cells of the heart and lymph node. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA processing; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleoplasm; cytoskeleton; tight junction; cytoplasm; plasma membrane

Molecular Function: protein binding

Biological Process: mRNA polyadenylation; cell adhesion; positive regulation of protein amino acid dephosphorylation

Research Articles on SYMPK

Similar Products

Product Notes

The SYMPK sympk (Catalog #AAA5302519) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Symplekin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SYMPK sympk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Symplekin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.