Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Tetraspanin 31 antibody (MBS5300938) used at 1 ug/ml to detect target protein.)

Rabbit Tetraspanin 31 Polyclonal Antibody | anti-TSPAN31 antibody

Tetraspanin 31 antibody

Gene Names
TSPAN31; SAS
Applications
Western Blot
Purity
Affinity purified
Synonyms
Tetraspanin 31; Polyclonal Antibody; Tetraspanin 31 antibody; Polyclonal Tetraspanin 31; Anti-Tetraspanin 31; TSPAN31; Tetraspanin -31; SAS; anti-TSPAN31 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Tetraspanin 31 antibody was raised against the middle region of TSPAN31
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN31 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
210
Applicable Applications for anti-TSPAN31 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TSPAN31 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.
Cross-Reactivity
Human
Immunogen
Tetraspanin 31 antibody was raised using the middle region of TSPAN31 corresponding to a region with amino acids CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Tetraspanin 31 antibody (MBS5300938) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Tetraspanin 31 antibody (MBS5300938) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TSPAN31 antibody
Rabbit polyclonal Tetraspanin 31 antibody raised against the middle region of TSPAN31
Product Categories/Family for anti-TSPAN31 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
23 kDa (MW of target protein)
NCBI Official Full Name
Tetraspanin 31
NCBI Official Synonym Full Names
tetraspanin 31
NCBI Official Symbol
TSPAN31
NCBI Official Synonym Symbols
SAS
NCBI Protein Information
tetraspanin-31
UniProt Protein Name
Tetraspanin-31
Protein Family
UniProt Gene Name
TSPAN31
UniProt Synonym Gene Names
SAS; Tspan-31
UniProt Entry Name
TSN31_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma. [provided by RefSeq, Jul 2008]

Uniprot Description

TSPAN31: is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: membrane; integral to plasma membrane

Biological Process: positive regulation of cell proliferation

Research Articles on TSPAN31

Similar Products

Product Notes

The TSPAN31 tspan31 (Catalog #AAA5300938) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Tetraspanin 31 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TSPAN31 tspan31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tetraspanin 31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.