Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KCNK4 antibody (MBS5302434) used at 1 ug/ml to detect target protein.)

Rabbit KCNK4 Polyclonal Antibody | anti-KCNK4 antibody

KCNK4 antibody

Gene Names
KCNK4; TRAAK; K2p4.1; TRAAK1
Applications
Western Blot
Purity
Affinity purified
Synonyms
KCNK4; Polyclonal Antibody; KCNK4 antibody; Polyclonal KCNK4; Anti-KCNK4; KCNK 4; KCNK-4; Potassium Channel Subfamily K Member 4; K2p4.1; TRAAK; TRAAK1; anti-KCNK4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
KCNK4 antibody was raised against the N terminal of KCNK4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNK4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
108
Applicable Applications for anti-KCNK4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids.
Cross-Reactivity
Human
Immunogen
KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(KCNK4 antibody (MBS5302434) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (KCNK4 antibody (MBS5302434) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-KCNK4 antibody
Rabbit polyclonal KCNK4 antibody raised against the N terminal of KCNK4
Product Categories/Family for anti-KCNK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
43 kDa (MW of target protein)
NCBI Official Full Name
KCNK4 protein, partial
NCBI Official Synonym Full Names
potassium channel, two pore domain subfamily K, member 4
NCBI Official Symbol
KCNK4
NCBI Official Synonym Symbols
TRAAK; K2p4.1; TRAAK1
NCBI Protein Information
potassium channel subfamily K member 4
UniProt Protein Name
Potassium channel subfamily K member 4
UniProt Gene Name
KCNK4
UniProt Synonym Gene Names
TRAAK; Two pore K(+) channel KT4.1
UniProt Entry Name
KCNK4_HUMAN

NCBI Description

Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The encoded protein homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNK4: Voltage insensitive, instantaneous, outwardly rectifying potassium channel. Outward rectification is reversed at high external K(+) concentrations. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: integral to membrane; plasma membrane

Molecular Function: potassium channel activity; voltage-gated ion channel activity

Biological Process: synaptic transmission; potassium ion transport

Research Articles on KCNK4

Similar Products

Product Notes

The KCNK4 kcnk4 (Catalog #AAA5302434) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KCNK4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KCNK4 kcnk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.