Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SPAG11B antibody (MBS5302112) used at 1 ug/ml to detect target protein.)

Rabbit SPAG11B Polyclonal Antibody | anti-SPAG11B antibody

SPAG11B antibody

Gene Names
SPAG11B; EP2; HE2; EP2C; EP2D; HE2C; EDDM2B; SPAG11
Applications
Western Blot
Purity
Affinity purified
Synonyms
SPAG11B; Polyclonal Antibody; SPAG11B antibody; Polyclonal SPAG11B; Anti-SPAG11B; EP2D; SPAGB-11; EP2; HE2; SPAG11; SPAGB 11; HE2C; MGC61846; EP2C; Sperm Associated Antigen 11B; anti-SPAG11B antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
SPAG11B antibody was raised against the N terminal of SPAG11B
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPAG11B antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
133
Applicable Applications for anti-SPAG11B antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.
Cross-Reactivity
Human
Immunogen
SPAG11B antibody was raised using the N terminal of SPAG11B corresponding to a region with amino acids MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SPAG11B antibody (MBS5302112) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (SPAG11B antibody (MBS5302112) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SPAG11B antibody
Rabbit polyclonal SPAG11B antibody raised against the N terminal of SPAG11B
Product Categories/Family for anti-SPAG11B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15 kDa (MW of target protein)
NCBI Official Full Name
sperm-associated antigen 11B isoform D preproprotein
NCBI Official Synonym Full Names
sperm associated antigen 11B
NCBI Official Symbol
SPAG11B
NCBI Official Synonym Symbols
EP2; HE2; EP2C; EP2D; HE2C; EDDM2B; SPAG11
NCBI Protein Information
sperm-associated antigen 11B
UniProt Protein Name
Sperm-associated antigen 11B
Protein Family
UniProt Gene Name
SPAG11B
UniProt Synonym Gene Names
EP2; HE2; He2
UniProt Entry Name
SG11B_HUMAN

NCBI Description

This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

SPAG11B: several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. [provided by RefSeq, Jul 2008]

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: extracellular region

Biological Process: spermatogenesis

Research Articles on SPAG11B

Similar Products

Product Notes

The SPAG11B spag11b (Catalog #AAA5302112) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SPAG11B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SPAG11B spag11b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPAG11B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.