Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DNASE1 antibody (MBS536439) used at 1 ug/ml to detect target protein.)

Rabbit DNASE1 Polyclonal Antibody | anti-DNASE1 antibody

DNASE1 antibody

Gene Names
DNASE1; DNL1; DRNI
Applications
Western Blot
Purity
Affinity purified
Synonyms
DNASE1; Polyclonal Antibody; DNASE1 antibody; Polyclonal DNASE1; Anti-DNASE1; DNL1; FLJ38093; DRNI; FLJ44902; Deoxyribonuclease I; DKFZp686H0155; anti-DNASE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
DNASE1 antibody was raised against the N terminal of DNASE1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNASE1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
282
Applicable Applications for anti-DNASE1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized.
Cross-Reactivity
Human
Immunogen
DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(DNASE1 antibody (MBS536439) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (DNASE1 antibody (MBS536439) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-DNASE1 antibody
Rabbit polyclonal DNASE1 antibody raised against the N terminal of DNASE1
Product Categories/Family for anti-DNASE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa (MW of target protein)
NCBI Official Full Name
deoxyribonuclease-1
NCBI Official Synonym Full Names
deoxyribonuclease I
NCBI Official Symbol
DNASE1
NCBI Official Synonym Symbols
DNL1; DRNI
NCBI Protein Information
deoxyribonuclease-1
UniProt Protein Name
Deoxyribonuclease-1
Protein Family
UniProt Gene Name
DNASE1
UniProt Synonym Gene Names
DNL1; DRNI; DNase I
UniProt Entry Name
DNAS1_HUMAN

NCBI Description

This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized, DNASE1*1 through DNASE1*6, and the sequence of DNASE1*2 represented in this record. Mutations in this gene have been associated with systemic lupus erythematosus (SLE), an autoimmune disease. A recombinant form of this protein is used to treat the one of the symptoms of cystic fibrosis by hydrolyzing the extracellular DNA in sputum and reducing its viscosity. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

DNASE1: Among other functions, seems to be involved in cell death by apoptosis. Binds specifically to G-actin and blocks actin polymerization. Defects in DNASE1 are a cause of susceptibility to systemic lupus erythematosus (SLE). A chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Belongs to the DNase I family.

Protein type: Deoxyribonuclease; Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis; EC 3.1.21.1

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: extracellular region; nuclear envelope; nucleus

Molecular Function: protein binding; deoxyribonuclease I activity; actin binding; endodeoxyribonuclease activity

Biological Process: apoptosis; DNA catabolic process, endonucleolytic

Disease: Systemic Lupus Erythematosus

Research Articles on DNASE1

Similar Products

Product Notes

The DNASE1 dnase1 (Catalog #AAA536439) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DNASE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the DNASE1 dnase1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DNASE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.