Western Blot (WB)
(Host: RabbitTarget Name: MAPKAP1Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse MAPKAP1 Polyclonal Antibody | anti-MAPKAP1 antibody
MAPKAP1 Antibody - middle region
Gene Names
Mapkap1; Sin1; AI591529; D230039K05Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAPKAP1; Polyclonal Antibody; MAPKAP1 Antibody - middle region; anti-MAPKAP1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISID
Sequence Length
486
Applicable Applications for anti-MAPKAP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse MAPKAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MAPKAP1Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MAPKAP1Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAPKAP1 antibody
Subunit of mTORC2, which regulates cell growth and survival in response to hormonal signals. mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'. Within mTORC2, MAPKAP1 is required for complex formation and mTORC2 kinase activity. MAPKAP1 inhibits MAP3K2 by preventing its dimerization and autophosphorylation. Inhibits HRAS and KRAS signaling. Enhances osmotic stress-induced phosphorylation of ATF2 and ATF2-mediated transcription. Isoform 1 is involved in ciliogenesis, regulates cilia length through its interaction with CCDC28B independently of mTORC2 complex.
Product Categories/Family for anti-MAPKAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
target of rapamycin complex 2 subunit MAPKAP1 isoform a
NCBI Official Synonym Full Names
mitogen-activated protein kinase associated protein 1
NCBI Official Symbol
Mapkap1
NCBI Official Synonym Symbols
Sin1; AI591529; D230039K05Rik
NCBI Protein Information
target of rapamycin complex 2 subunit MAPKAP1
UniProt Protein Name
Target of rapamycin complex 2 subunit MAPKAP1
Protein Family
UniProt Gene Name
Mapkap1
UniProt Synonym Gene Names
Mip1; Sin1; TORC2 subunit MAPKAP1; SAPK-interacting protein 1
UniProt Entry Name
SIN1_MOUSE
Research Articles on MAPKAP1
Similar Products
Product Notes
The MAPKAP1 mapkap1 (Catalog #AAA3224152) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPKAP1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MAPKAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPKAP1 mapkap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KSFKVSMIHR LRFTTDVQLG ISGDKVEIDP VTNQKASTKF WIKQKPISID. It is sometimes possible for the material contained within the vial of "MAPKAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
