Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SIN1Sample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MAPKAP1 Polyclonal Antibody | anti-MAPKAP1 antibody

MAPKAP1 Antibody - N-terminal region

Gene Names
MAPKAP1; MIP1; SIN1; JC310; SIN1b; SIN1g
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAPKAP1; Polyclonal Antibody; MAPKAP1 Antibody - N-terminal region; anti-MAPKAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTAT
Sequence Length
522
Applicable Applications for anti-MAPKAP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SIN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SIN1Sample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SIN1Sample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MAPKAP1 antibody
This is a rabbit polyclonal antibody against SIN1. It was validated on Western Blot

Target Description: This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene.
Product Categories/Family for anti-MAPKAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Synonym Full Names
mitogen-activated protein kinase associated protein 1
NCBI Official Symbol
MAPKAP1
NCBI Official Synonym Symbols
MIP1; SIN1; JC310; SIN1b; SIN1g
NCBI Protein Information
target of rapamycin complex 2 subunit MAPKAP1
UniProt Protein Name
Target of rapamycin complex 2 subunit MAPKAP1
UniProt Gene Name
MAPKAP1
UniProt Synonym Gene Names
MIP1; SIN1; TORC2 subunit MAPKAP1; SAPK-interacting protein 1; mSIN1
UniProt Entry Name
SIN1_HUMAN

NCBI Description

This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Sin1: a member of a conserved family of proteins that have an essential roles in signal transduction from yeast to mammals. An essential component of the mTORC2 complex, which consists of mTOR, LST8, Sin1, Protor (PRR5), and RICTOR, the Rapamycin Insensitive Companion of mTOR. mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 regulates the phosphorylation of SGK1 S422 and PKCA S657. Enhances osmotic stress-induced phosphorylation of ATF2 and ATF2-mediated transcription. Contains a Ras-binding (RBD) and a pleckstrin homology (PH) domains. Plays an important role in the SAPK signaling pathway by binding directly to both ATF-2 and p38. A genetic knockout of Sin1 abolished Akt-S473 phosphorylation and disrupts the RICTOR-mTOR interaction, but Akt-Thr308 phosphorylation is maintained. Six alternatively-spliced isoforms of the human protein have been reported. All isoforms except 4 can be incorporated into the the mTORC2 complex.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 9q33.3

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasmic membrane-bound vesicle; cytoplasm; plasma membrane; cytosol; nucleus

Molecular Function: protein binding; phosphatidylinositol-4,5-bisphosphate binding; phosphatidylinositol-3,4,5-triphosphate binding; Ras GTPase binding; phosphatidylinositol-3,4-bisphosphate binding; protein kinase binding

Biological Process: epidermal growth factor receptor signaling pathway; substantia nigra development; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; T cell costimulation; innate immune response; negative regulation of Ras protein signal transduction; vascular endothelial growth factor receptor signaling pathway

Research Articles on MAPKAP1

Similar Products

Product Notes

The MAPKAP1 mapkap1 (Catalog #AAA3220104) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPKAP1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPKAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAPKAP1 mapkap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKKSLKEKPP ISGKQSILSV RLEQCPLQLN NPFNEYSKFD GKGHVGTTAT. It is sometimes possible for the material contained within the vial of "MAPKAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.