Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human TWSG1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-40kDa.)

TWSG1 recombinant protein

Recombinant Human TWSG1 Protein

Gene Names
TWSG1; TSG
Purity
>95% by SDS-PAGE.
Synonyms
TWSG1; Recombinant Human TWSG1 Protein; TSG; TSGtwisted gastrulation protein homolog 1; TWSG1 recombinant protein
Ordering
For Research Use Only!
Host
HEK293
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Sequence Length
223
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human TWSG1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-40kDa.)

SDS-Page (Recombinant Human TWSG1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-40kDa.)
Related Product Information for TWSG1 recombinant protein
Recombinant Human TWSG1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Phe223) of human TWSG1 (Accession #NP_065699.1) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for TWSG1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
twisted gastrulation protein homolog 1
NCBI Official Synonym Full Names
twisted gastrulation BMP signaling modulator 1
NCBI Official Symbol
TWSG1
NCBI Official Synonym Symbols
TSG
NCBI Protein Information
twisted gastrulation protein homolog 1
UniProt Protein Name
Twisted gastrulation protein homolog 1
UniProt Gene Name
TWSG1
UniProt Synonym Gene Names
TSG
UniProt Entry Name
TWSG1_HUMAN

Uniprot Description

TWSG1: May be involved in dorsoventral axis formation. Seems to antagonize BMP signaling by forming ternary complexes with CHRD and BMPs, thereby preventing BMPs from binding to their receptors. In addition to the anti-BMP function, also has pro-BMP activity, partly mediated by cleavage and degradation of CHRD, which releases BMPs from ternary complexes. May be an important modulator of BMP-regulated cartilage development and chondrocyte differentiation. May play a role in thymocyte development. Belongs to the twisted gastrulation protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 18p11.3

Molecular Function: protein binding

Research Articles on TWSG1

Similar Products

Product Notes

The TWSG1 twsg1 (Catalog #AAA9141880) is a Recombinant Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MKLHYVAVLT LAILMFLTWL PESLSCNKAL CASDVSKCLI QELCQCRPGE GNCSCCKECM LCLGALWDEC CDCVGMCNPR NYSDTPPTSK STVEELHEPI PSLFRALTEG DTQLNWNIVS FPVAEELSHH ENLVSFLETV NQPHHQNVSV PSNNVHAPYS SDKEHMCTVV YFDDCMSIHQ CKISCESMGA SKYRWFHNAC CECIGPECID YGSKTVKCMN CMF. It is sometimes possible for the material contained within the vial of "TWSG1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.