Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human TROP-2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-40kDa.)

TROP-2 recombinant protein

Recombinant Human TROP-2 Protein

Gene Names
TACSTD2; EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Purity
>70% by SDS-PAGE.
Synonyms
TROP-2; Recombinant Human TROP-2 Protein; EGP-1; EGP1; GA733-1; GA7331; GP50; M1S1; TACD2; TROP2; TROP-2 recombinant protein
Ordering
For Research Use Only!
Host
HEK293
Purity/Purification
>70% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Sequence
TLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Sequence Length
323
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human TROP-2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-40kDa.)

SDS-Page (Recombinant Human TROP-2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-40kDa.)
Related Product Information for TROP-2 recombinant protein
Recombinant Human TROP-2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr88-Thr274) of human TROP-2 (Accession #NP_002344.2) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for TROP-2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tumor-associated calcium signal transducer 2
NCBI Official Synonym Full Names
tumor associated calcium signal transducer 2
NCBI Official Symbol
TACSTD2
NCBI Official Synonym Symbols
EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
NCBI Protein Information
tumor-associated calcium signal transducer 2
UniProt Protein Name
Tumor-associated calcium signal transducer 2
UniProt Gene Name
TACSTD2
UniProt Synonym Gene Names
GA733-1; M1S1; TROP2
UniProt Entry Name
TACD2_HUMAN

NCBI Description

This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009]

Uniprot Description

TACSTD2: May function as a growth factor receptor. Defects in TACSTD2 are the cause of gelatinous drop-like corneal dystrophy (GDLD); also known as lattice corneal dystrophy type III. GDLD is an autosomal recessive disorder characterized by grayish corneal amyloid deposits that cause severe visual impairment. Belongs to the EPCAM family.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: extracellular space; membrane; integral to plasma membrane; basal plasma membrane; nucleus; cytosol; lateral plasma membrane

Molecular Function: protein binding; receptor activity

Biological Process: cell proliferation; cell surface receptor linked signal transduction; negative regulation of stress fiber formation; visual perception; regulation of epithelial cell proliferation

Disease: Corneal Dystrophy, Gelatinous Drop-like

Research Articles on TROP-2

Similar Products

Product Notes

The TROP-2 tacstd2 (Catalog #AAA9141879) is a Recombinant Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TLVRPSEHAL VDNDGLYDPD CDPEGRFKAR QCNQTSVCWC VNSVGVRRTD KGDLSLRCDE LVRTHHILID LRHRPTAGAF NHSDLDAELR RLFRERYRLH PKFVAAVHYE QPTIQIELRQ NTSQKAAGDV DIGDAAYYFE RDIKGESLFQ GRGGLDLRVR GEPLQVERTL IYYLDEIPPK FSMKRLT. It is sometimes possible for the material contained within the vial of "TROP-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.