JAK2, active Active Protein
JAK2, active, Recombinant, Human (Janus Kinase 2)
Purity
PurifiedPurified using Ni2+/NTA agarose. ~60% by SDS-PAGE and Coomassie blue staining.
Synonyms
JAK2; active; Recombinant; Human (Janus Kinase 2); active active protein
Host
Sf21 cells
Purity/Purification
Purified
Purified using Ni2+/NTA agarose. ~60% by SDS-PAGE and Coomassie blue staining.
Purified using Ni2+/NTA agarose. ~60% by SDS-PAGE and Coomassie blue staining.
Form/Format
Supplied as a liquid in 50mM Tris-HCl, pH 7.5, 300mM sodium chloride, 0.1mM EGTA, 0.03% Brij-35, 270mM sucrose, 1mM benzamidine, 0.2mM PMSF and 0.1% 2-mercaptoethanol.
Application Notes
MS Tryptic Fingerprint: Confirmed identity as JAK2 with 40% amino acid coverage of the translated native sequence., JAK2 Kinase Assay: 3.1-12.4ng of this lot of enzyme phosphorylated 100uM PDKtide in the assay. Assay background was subtracted from the actual counts to yield the results.
Specific Activity
~4000U/mg, where one unit of JAK2 activity is defined as 1nmol phosphate incorporated into 100uM PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) per minute at 30 degree C with a final ATP concentration of 100uM.
Preparation and Storage
May be stored at 4 degree C for short-term only. For long-term storage, store at -20 degree C. Aliquots are stable for at least 6 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for JAK2, active active protein
The Janus (JAK) family of cytoplasmic tyrosine kinases has been implicated in signal transduction induced by cytokines and growth factors, physically associated with ligand-bound receptors. This association that results in tyrosine phosphorylation and activation. JAK1 is approximately 130kD and contains a C-terminal tyrosine kinase domain, an adjacent kinase or kinase-related domain, and five other domains that are highly conserved among JAK family members. Family members such as JAK1, JAK2, and TYK2 are ubiquitous, whereas JAK3 is predominantly expressed in T lymphocytes. Studies with mutant cells that do not express JAK1, JAK2, or TYK2 show that their activation is essential for cellular signaling. JAK family kinases may either phosphorylate each other or be phosphorylated by a yet undescribed tyrosine kinase. Different cytokines can activate via phosphorylation distinct JAK family members. In some cells, the membrane-associated gp130 protein has been implicated in the induction of JAK family phosphorylation, although gp130 itself has no known activity.
C-terminal His6-tagged, recombinant, human JAK2, aa808-end, expressed by baculovirus in Sf21 cells.
C-terminal His6-tagged, recombinant, human JAK2, aa808-end, expressed by baculovirus in Sf21 cells.
Product Categories/Family for JAK2, active active protein
Similar Products
Product Notes
The JAK2, active (Catalog #AAA635815) is an Active Protein produced from Sf21 cells and is intended for research purposes only. The product is available for immediate purchase. MS Tryptic Fingerprint: Confirmed identity as JAK2 with 40% amino acid coverage of the translated native sequence., JAK2 Kinase Assay: 3.1-12.4ng of this lot of enzyme phosphorylated 100uM PDKtide in the assay. Assay background was subtracted from the actual counts to yield the results. Researchers should empirically determine the suitability of the JAK2, active for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "JAK2, active, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
