Rabbit anti-Mouse TEN1 Polyclonal Antibody | anti-TEN1 antibody

TEN1 Antibody - N-terminal region

Cat. Num. AAA3223729

• Gene Names: Ten1; 2310004N24Rik
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: TEN1; Polyclonal Antibody; TEN1 Antibody - N-terminal region; anti-TEN1 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GSTLRTFGRLYLYDMARSLMTLAAPQKPDQCQLLVCTNLVEPFEAHVNFL
• Sequence Length: 161

• Applicable Applications for anti-TEN1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of Mouse TEN1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TEN1Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-TEN1 antibody

Component of the CST complex proposed to act as a specialized replication factor promoting DNA replication under conditions of replication stress or natural replication barriers such as the telomere duplex. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. Initially the CST complex has been proposed to protect telomeres from DNA degradation. However, the CST complex has been shown to be involved in several aspects of telomere replication. The CST complex inhibits telomerase and is involved in telomere length homeostasis; it is proposed to bind to newly telomerase-synthesized 3' overhangs and to terminate telomerase action implicating the association with the ACD:POT1 complex thus interfering with its telomerase stimulation activity. The CST complex is also proposed to be involved in fill-in synthesis of the telomeric C-strand probably implicating recruitment and activation of DNA polymerase alpha. The CST complex facilitates recovery from many forms of exogenous DNA damage; seems to be involved in the re-initiation of DNA replication at repaired forks and/or dormant origins (By similarity).

Product Categories/Family for anti-TEN1 antibody

Polyclonal; DNA Damage & Repair; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 254675210
• NCBI GeneID: 69535
• NCBI Accession #: NP_081383.1
• NCBI GenBank Nucleotide #: NM_027107.1
• UniProt Accession #: Q9D7K2
• Molecular Weight: 18 kDa
• NCBI Official Full Name: CST complex subunit TEN1
• NCBI Official Synonym Full Names: TEN1 telomerase capping complex subunit
• NCBI Official Symbol: Ten1
• NCBI Official Synonym Symbols: 2310004N24Rik
• NCBI Protein Information: CST complex subunit TEN1
• UniProt Protein Name: CST complex subunit TEN1
• Protein Family: Telomere length regulation protein
• UniProt Gene Name: Ten1

Uniprot Description

Component of the CST complex proposed to act as a specialized replication factor promoting DNA replication under conditions of replication stress or natural replication barriers such as the telomere duplex. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. Initially the CST complex has been proposed to protect telomeres from DNA degradation (PubMed:19854130). However, the CST complex has been shown to be involved in several aspects of telomere replication. The CST complex inhibits telomerase and is involved in telomere length homeostasis; it is proposed to bind to newly telomerase-synthesized 3' overhangs and to terminate telomerase action implicating the association with the ACD:POT1 complex thus interfering with its telomerase stimulation activity. The CST complex is also proposed to be involved in fill-in synthesis of the telomeric C-strand probably implicating recruitment and activation of DNA polymerase alpha. The CST complex facilitates recovery from many forms of exogenous DNA damage; seems to be involved in the re-initiation of DNA replication at repaired forks and/or dormant origins ().