Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TERTSample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TERT Polyclonal Antibody | anti-TERT antibody

TERT Antibody - C-terminal region

Gene Names
TERT; TP2; TRT; CMM9; EST2; TCS1; hTRT; DKCA2; DKCB4; hEST2; PFBMFT1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TERT; Polyclonal Antibody; TERT Antibody - C-terminal region; anti-TERT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALP
Sequence Length
1132
Applicable Applications for anti-TERT antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TERT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TERTSample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TERTSample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TERT antibody
This is a rabbit polyclonal antibody against TERT. It was validated on Western Blot

Target Description: Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity.
Product Categories/Family for anti-TERT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
127kDa
NCBI Official Full Name
telomerase reverse transcriptase isoform 2
NCBI Official Synonym Full Names
telomerase reverse transcriptase
NCBI Official Symbol
TERT
NCBI Official Synonym Symbols
TP2; TRT; CMM9; EST2; TCS1; hTRT; DKCA2; DKCB4; hEST2; PFBMFT1
NCBI Protein Information
telomerase reverse transcriptase
UniProt Protein Name
Telomerase reverse transcriptase
Protein Family
UniProt Gene Name
TERT
UniProt Synonym Gene Names
EST2; TCS1; TRT; TP2
UniProt Entry Name
TERT_HUMAN

NCBI Description

Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity. [provided by RefSeq, Jul 2008]

Uniprot Description

TERT: telomerase reverse transcriptase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The holoenzyme consists of TERT and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced isoforms have been identified, although the full-length sequence of some variants has not been determined.

Protein type: Transferase; EC 2.7.7.49; DNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 5p15.33

Cellular Component: nucleoplasm; chromosome, telomeric region; PML body; nuclear telomere cap complex; telomerase holoenzyme complex; nucleolus

Molecular Function: telomerase activity; protein binding; RNA-directed RNA polymerase activity; protein homodimerization activity; DNA binding; metal ion binding; telomeric DNA binding; RNA-directed DNA polymerase activity; telomeric template RNA reverse transcriptase activity; nucleotidyltransferase activity; tRNA binding

Biological Process: mitochondrion organization and biogenesis; DNA strand elongation; RNA-dependent DNA replication; positive regulation of nitric-oxide synthase activity; telomere maintenance via telomerase; age-dependent telomere shortening; telomere maintenance; positive regulation of Wnt receptor signaling pathway; RNA interference, production of siRNA

Disease: Pulmonary Fibrosis, Idiopathic; Aplastic Anemia; Dyskeratosis Congenita, Autosomal Dominant, 1

Research Articles on TERT

Similar Products

Product Notes

The TERT tert (Catalog #AAA3200200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TERT Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TERT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TERT tert for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HQAFLLKLTR HRVTYVPLLG SLRTAQTQLS RKLPGTTLTA LEAAANPALP. It is sometimes possible for the material contained within the vial of "TERT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.