Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: XRCC4Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human XRCC4 Polyclonal Antibody | anti-XRCC4 antibody

XRCC4 Antibody - middle region

Gene Names
XRCC4; SSMED
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
XRCC4; Polyclonal Antibody; XRCC4 Antibody - middle region; anti-XRCC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCV
Sequence Length
310
Applicable Applications for anti-XRCC4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human XRCC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: XRCC4Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: XRCC4Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-XRCC4 antibody
The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternative splicing generates several transcript variants.
Product Categories/Family for anti-XRCC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Synonym Full Names
X-ray repair cross complementing 4
NCBI Official Symbol
XRCC4
NCBI Official Synonym Symbols
SSMED
NCBI Protein Information
DNA repair protein XRCC4
UniProt Protein Name
DNA repair protein XRCC4
Protein Family
UniProt Gene Name
XRCC4
UniProt Entry Name
XRCC4_HUMAN

NCBI Description

The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternative splicing generates several transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

XRCC4: Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. Binds to DNA and to DNA ligase IV (LIG4). The LIG4-XRCC4 complex is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of LIG4. Binding of the LIG4-XRCC4 complex to DNA ends is dependent on the assembly of the DNA-dependent protein kinase complex DNA-PK to these DNA ends. Homodimer and homotetramer in solution. The homodimer associates with LIG4, and the LIG4-XRCC4 complex associates in a DNA-dependent manner with the DNA-PK complex formed by the Ku p70/p86 dimer (XRCC6/XRCC5) and PRKDC. Seems to interact directly with PRKDC but not with the Ku p70/86 dimer. Interacts with XLF/Cernunnos. Interacts with APTX and APLF. Widely expressed. Belongs to the XRCC4 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 5q14.2

Cellular Component: nucleoplasm; DNA ligase IV complex; centrosome; condensed chromosome; DNA-dependent protein kinase complex; cytosol; cell junction; nucleus

Molecular Function: protein C-terminus binding; protein binding; DNA binding; ligase activity

Biological Process: pro-B cell differentiation; positive regulation of neurogenesis; central nervous system development; viral reproduction; immunoglobulin V(D)J recombination; in utero embryonic development; T cell differentiation in the thymus; isotype switching; DNA repair; double-strand break repair via nonhomologous end joining; positive regulation of fibroblast proliferation; double-strand break repair; DNA ligation during DNA repair; response to gamma radiation; negative regulation of neuron apoptosis; positive regulation of ligase activity; response to X-ray

Disease: Short Stature, Microcephaly, And Endocrine Dysfunction

Research Articles on XRCC4

Similar Products

Product Notes

The XRCC4 xrcc4 (Catalog #AAA3223158) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XRCC4 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XRCC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the XRCC4 xrcc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENPAEVIREL ICYCLDTIAE NQAKNEHLQK ENERLLRDWN DVQGRFEKCV. It is sometimes possible for the material contained within the vial of "XRCC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.