Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ORC5Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ORC5 Polyclonal Antibody | anti-ORC5 antibody

ORC5 Antibody - middle region

Gene Names
ORC5; ORC5L; ORC5P; ORC5T; PPP1R117
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ORC5; Polyclonal Antibody; ORC5 Antibody - middle region; anti-ORC5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDK
Sequence Length
324
Applicable Applications for anti-ORC5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ORC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ORC5Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ORC5Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ORC5 antibody
The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Product Categories/Family for anti-ORC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
origin recognition complex subunit 5 isoform 1
NCBI Official Synonym Full Names
origin recognition complex subunit 5
NCBI Official Symbol
ORC5
NCBI Official Synonym Symbols
ORC5L; ORC5P; ORC5T; PPP1R117
NCBI Protein Information
origin recognition complex subunit 5
UniProt Protein Name
Origin recognition complex subunit 5
UniProt Gene Name
ORC5
UniProt Synonym Gene Names
ORC5L
UniProt Entry Name
ORC5_HUMAN

NCBI Description

The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Oct 2010]

Uniprot Description

ORC5L: Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Belongs to the ORC5 family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: nucleoplasm; cytoplasm; nuclear origin of replication recognition complex; nucleus; origin recognition complex

Molecular Function: protein binding; nucleotide binding; DNA replication origin binding; ATP binding

Biological Process: DNA replication initiation; mitotic cell cycle; DNA replication; G1/S transition of mitotic cell cycle

Research Articles on ORC5

Similar Products

Product Notes

The ORC5 orc5 (Catalog #AAA3221926) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ORC5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ORC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ORC5 orc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQWEKLQKDD TDPGQLKGLS AHTHVELPYY SKFILIAAYL ASYNPARTDK. It is sometimes possible for the material contained within the vial of "ORC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.