Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MCRS1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MCRS1 Polyclonal Antibody | anti-MCRS1 antibody

MCRS1 Antibody - N-terminal region

Gene Names
MCRS1; P78; MCRS2; MSP58; INO80Q; ICP22BP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MCRS1; Polyclonal Antibody; MCRS1 Antibody - N-terminal region; anti-MCRS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEDEESLAGQKRASSQALGTIPKRRSSSRFIKRKKFDDELVESSLAKSST
Sequence Length
462
Applicable Applications for anti-MCRS1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MCRS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MCRS1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MCRS1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MCRS1 antibody
Modulates the transcription repressor activity of DAXX by recruiting it to the nucleolus. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. May also be an inhibitor of TERT telomerase activity. Binds to G-quadruplex structures in mRNA. Binds to RNA homopolymer poly(G) and poly(U).
Product Categories/Family for anti-MCRS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 kDa
NCBI Official Full Name
microspherule protein 1 isoform 2
NCBI Official Synonym Full Names
microspherule protein 1
NCBI Official Symbol
MCRS1
NCBI Official Synonym Symbols
P78; MCRS2; MSP58; INO80Q; ICP22BP
NCBI Protein Information
microspherule protein 1
UniProt Protein Name
Microspherule protein 1
Protein Family
UniProt Gene Name
MCRS1
UniProt Synonym Gene Names
INO80Q; MSP58
UniProt Entry Name
MCRS1_HUMAN

Uniprot Description

Function: Modulates the transcription repressor activity of DAXX by recruiting it to the nucleolus. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. May also be an inhibitor of TERT telomerase activity. Ref.3 Ref.5 Ref.15

Subunit structure: Binds to NOP2, DAXX, PINX1, TERT and Herpes simplex virus ICP22. Interacts with CCDC85B. Component of the chromatin remodeling INO80 complex; specifically part of a complex module associated with the N-terminus of INO80. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Component of the NSL complex at least composed of MOF/KAT8, KANSL1, KANSL2, KANSL3, MCRS1, PHF20, OGT1/OGT, WDR5 and HCFC1. Ref.1 Ref.2 Ref.3 Ref.6 Ref.7 Ref.8 Ref.10 Ref.15 Ref.17

Subcellular location: Nucleus. Nucleus › nucleolus. Note: In microspherules in the nucleolus. Ref.1 Ref.3 Ref.10 Ref.15

Tissue specificity: Detected in testis, and at lower levels in spleen, thymus, prostate, uterus, small intestine, colon and leukocytes.

Developmental stage: Cell-cycle regulated: levels are highest early in S phase; not detectable in G2.

Sequence similarities: Contains 1 FHA domain.

Sequence caution: The sequence AAC68599.1 differs from that shown. Reason: Frameshift at several positions.

Research Articles on MCRS1

Similar Products

Product Notes

The MCRS1 mcrs1 (Catalog #AAA3223504) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MCRS1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCRS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MCRS1 mcrs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEDEESLAGQ KRASSQALGT IPKRRSSSRF IKRKKFDDEL VESSLAKSST. It is sometimes possible for the material contained within the vial of "MCRS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.