Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GPR3 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)

Rabbit GPR3 Polyclonal Antibody | anti-GPR3 antibody

GPR3 antibody - C-terminal region

Gene Names
GPR3; ACCA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPR3; Polyclonal Antibody; GPR3 antibody - C-terminal region; anti-GPR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRS
Sequence Length
330
Applicable Applications for anti-GPR3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPR3 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)

Western Blot (WB) (WB Suggested Anti-GPR3 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)
Related Product Information for anti-GPR3 antibody
This is a rabbit polyclonal antibody against GPR3. It was validated on Western Blot

Target Description: GPR3 is a orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. GPR3 has a potential role in modulating a number of brain functions, including behavioral responses to stress, amyloid-beta peptide generation in neurons and neurite outgrowth. GPR3 maintains also meiotic arrest in oocytes.
Product Categories/Family for anti-GPR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
G-protein coupled receptor 3
NCBI Official Synonym Full Names
G protein-coupled receptor 3
NCBI Official Symbol
GPR3
NCBI Official Synonym Symbols
ACCA
NCBI Protein Information
G-protein coupled receptor 3
UniProt Protein Name
G-protein coupled receptor 3
UniProt Gene Name
GPR3
UniProt Synonym Gene Names
ACCA
UniProt Entry Name
GPR3_HUMAN

NCBI Description

This gene is a member of the G protein-coupled receptor family and is found in the cell membrane. G protein-coupled receptors, characterized by a seven transmembrane domain motif, are involved in translating outside signals into G protein mediated intracellular effects. The encoded protein activates adenylate cyclase and modulates amyloid-beta production in a mouse model, suggesting that it may play a role in Alzheimer's disease. [provided by RefSeq, Oct 2012]

Uniprot Description

GPR3: Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Has a potential role in modulating a number of brain functions, including behavioral responses to stress, amyloid-beta peptide generation in neurons and neurite outgrowth. Maintains also meiotic arrest in oocytes. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Cell cycle regulation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.1-p35

Cellular Component: integral to plasma membrane

Molecular Function: G-protein coupled receptor activity; protein binding

Biological Process: elevation of cytosolic calcium ion concentration; regulation of meiosis; positive regulation of cAMP metabolic process; G-protein signaling, adenylate cyclase activating pathway

Research Articles on GPR3

Similar Products

Product Notes

The GPR3 gpr3 (Catalog #AAA3216379) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GPR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPR3 gpr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPLYTYLTLL PATYNSMINP IIYAFRNQDV QKVLWAVCCC CSSSKIPFRS. It is sometimes possible for the material contained within the vial of "GPR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.