Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Esrrg AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)

Rabbit Esrrg Polyclonal Antibody | anti-ESRRG antibody

Esrrg antibody - middle region

Gene Names
Esrrg; errg
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Esrrg; Polyclonal Antibody; Esrrg antibody - middle region; anti-ESRRG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI
Sequence Length
458
Applicable Applications for anti-ESRRG antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Esrrg AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)

Western Blot (WB) (WB Suggested Anti-Esrrg AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)
Related Product Information for anti-ESRRG antibody
This is a rabbit polyclonal antibody against Esrrg. It was validated on Western Blot

Target Description: Esrrg is an orphan receptor that acts as transcription activator in the absence of bound ligand. It binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
estrogen-related receptor gamma
NCBI Official Synonym Full Names
estrogen-related receptor gamma
NCBI Official Symbol
Esrrg
NCBI Official Synonym Symbols
errg
NCBI Protein Information
estrogen-related receptor gamma
UniProt Protein Name
Estrogen-related receptor gamma
Protein Family
UniProt Gene Name
Esrrg
UniProt Synonym Gene Names
Errg; Nr3b3

Uniprot Description

ERR3: Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements. Belongs to the nuclear hormone receptor family. NR3 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor; Transcription factor

Chromosomal Location of Human Ortholog: 13q26

Cellular Component: nucleus

Molecular Function: AF-2 domain binding; retinoic acid receptor activity; steroid binding; steroid hormone receptor activity; zinc ion binding

Biological Process: positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-templated; regulation of transcription, DNA-templated; retinoic acid receptor signaling pathway; steroid hormone mediated signaling; transcription from RNA polymerase II promoter

Research Articles on ESRRG

Similar Products

Product Notes

The ESRRG esrrg (Catalog #AAA3200829) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Esrrg antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Esrrg can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ESRRG esrrg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIDAENSPYL NPQLVQPAKK PYNKIVSHLL VAEPEKIYAM PDPTVPDSDI. It is sometimes possible for the material contained within the vial of "Esrrg, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.