Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SYCE2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

Rabbit anti-Human SYCE2 Polyclonal Antibody | anti-SYCE2 antibody

SYCE2 Antibody - C-terminal region

Gene Names
SYCE2; CESC1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SYCE2; Polyclonal Antibody; SYCE2 Antibody - C-terminal region; anti-SYCE2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFV
Sequence Length
218
Applicable Applications for anti-SYCE2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SYCE2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SYCE2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

Western Blot (WB) (WB Suggested Anti-SYCE2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Related Product Information for anti-SYCE2 antibody
This is a rabbit polyclonal antibody against SYCE2. It was validated on Western Blot

Target Description: SYCE2 is a major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. SYCE2 requires SYCP1 in order to be incorporated into the central element and may have a role in the synaptonemal complex assembly, stabilization and recombination.
Product Categories/Family for anti-SYCE2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
synaptonemal complex central element protein 2
NCBI Official Synonym Full Names
synaptonemal complex central element protein 2
NCBI Official Symbol
SYCE2
NCBI Official Synonym Symbols
CESC1
NCBI Protein Information
synaptonemal complex central element protein 2
UniProt Protein Name
Synaptonemal complex central element protein 2
UniProt Gene Name
SYCE2
UniProt Synonym Gene Names
CESC1
UniProt Entry Name
SYCE2_HUMAN

NCBI Description

The protein encoded by this gene is part of the synaptonemal complex formed between homologous chromosomes during meiotic prophase. The encoded protein associates with SYCP1 and SYCE1 and is found only where chromosome cores are synapsed. [provided by RefSeq, Dec 2012]

Uniprot Description

Function: Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complex assembly, stabilization and recombination

By similarity.

Subunit structure: Homodimer. Found in a complex with SYCP1 and SYCE1. Interacts with SYCP1, SYCE1 and SYCE3

By similarity.

Subcellular location: Nucleus. Note: Associates with chromatin. In prophase I stage of meiosis, localizes in the transverse central elements of the central region between lateral elements of the synaptonemal complexes. Found only where the chromosome cores are synapsed. Colocalizes with SYCE1 in the central elements

By similarity.

Sequence similarities: Belongs to the SYCE family.

Research Articles on SYCE2

Similar Products

Product Notes

The SYCE2 syce2 (Catalog #AAA3217306) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYCE2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SYCE2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYCE2 syce2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKQVCHSVET VYKDLCLQPE QSLRLRWGPD HSRGKSPPRP GNSQPPDVFV. It is sometimes possible for the material contained within the vial of "SYCE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.