Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DRD1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Rabbit DRD1 Polyclonal Antibody | anti-DRD1 antibody

DRD1 antibody - N-terminal region

Gene Names
DRD1; DADR; DRD1A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DRD1; Polyclonal Antibody; DRD1 antibody - N-terminal region; anti-DRD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDS
Sequence Length
446
Applicable Applications for anti-DRD1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DRD1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Western Blot (WB) (WB Suggested Anti-DRD1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Related Product Information for anti-DRD1 antibody
This is a rabbit polyclonal antibody against DRD1. It was validated on Western Blot

Target Description: This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
D(1A) dopamine receptor
NCBI Official Synonym Full Names
dopamine receptor D1
NCBI Official Symbol
DRD1
NCBI Official Synonym Symbols
DADR; DRD1A
NCBI Protein Information
D(1A) dopamine receptor
UniProt Protein Name
D(1A) dopamine receptor
Protein Family
UniProt Gene Name
DRD1
UniProt Entry Name
DRD1_HUMAN

NCBI Description

This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DRD1: a G-protein coupled receptor.One of the five types (D1 to D5) of receptors for dopamine. The most abundant dopamine receptor in the central nervous system. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Interacts with calcyon.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: endoplasmic reticulum membrane; integral to plasma membrane; plasma membrane; nucleus

Molecular Function: protein binding; dopamine receptor activity; dopamine binding; dopamine D1 receptor-like receptor activity

Biological Process: synaptic transmission, dopaminergic; peristalsis; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); behavioral fear response; prepulse inhibition; positive regulation of potassium ion transport; generation of action potential; thermoregulation; G-protein signaling, adenylate cyclase activating pathway; vasodilation; positive regulation of synaptic transmission, glutamatergic; adult walking behavior; dopamine metabolic process; synaptogenesis; behavioral response to cocaine; protein import into nucleus; conditioned taste aversion; positive regulation of cAMP biosynthetic process; visual learning; dopamine receptor, adenylate cyclase activating pathway; grooming behavior; response to drug; dopamine transport; dentate gyrus development; cerebral cortex GABAergic interneuron migration; striatum development; maternal behavior; response to amphetamine; adenylate cyclase activation; regulation of dopamine metabolic process; mating behavior; regulation of dopamine uptake; transmission of nerve impulse; astrocyte development; memory; G-protein signaling, coupled to cyclic nucleotide second messenger; habituation; glucose import; operant conditioning; sensitization; positive regulation of release of sequestered calcium ion into cytosol; dopamine receptor, phospholipase C activating pathway; positive regulation of cell migration

Research Articles on DRD1

Similar Products

Product Notes

The DRD1 drd1 (Catalog #AAA3216102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DRD1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DRD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DRD1 drd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAFILISVAW TLSVLISFIP VQLSWHKAKP TSPSDGNATS LAETIDNCDS. It is sometimes possible for the material contained within the vial of "DRD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.